KEGG   Acidovorax avenae: Acav_2119Help
Entry
Acav_2119         CDS       T01445                                 

Definition
(GenBank) Phosphonate-transporting ATPase
  KO
K05833  putative ABC transport system ATP-binding protein
Organism
aaa  Acidovorax avenae
Module
aaa_M00247  Putative ABC transport system
Brite
Transporters [BR:aaa02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative ABC transporter [MD:M00247] [OT]
    Acav_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 ABC_ATPase RsgA_GTPase AAA_23 MMR_HSR1 Dynamin_N AAA_27 AAA_15 AAA Zeta_toxin IIGP
Motif
Other DBs
NCBI-ProteinID: ADX46031
UniProt: F0QAJ0
Position
complement(2365377..2366171)
Genome map
AA seq 264 aa AA seqDB search
MLSAQDLHITFNPGTPIETRALRGMSLDIPAGQFVTVIGSNGAGKSTFLNAISGDLGVDA
GRIAIDGEDVTRLPVWERAPRVARVFQDPMAGTCEDLTIEENMALARQRGAGRGLRGAVK
ATDRALFRERLATLGLGLENRLADRIGLLSGGQRQAVSLLMAALQPSRILLLDEHTAALD
PRTADFVLQLTARIVAESRLTAMMVTHSMRQALDVGDRTVMLHQGQVVLDVSGEERSRLD
VPDLLRMFETVRGEKLADDALLLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgcacaagacctgcacatcaccttcaaccccggcacaccgatcgagacgcgc
gcgctgcgcggcatgtcactggacatcccggccgggcagttcgtcaccgtcatcggctcc
aacggggccggcaaatccaccttcctcaacgccatctcgggcgacctgggcgtggacgcg
ggccgcatcgccatcgacggcgaggacgtcacgcgcctgcccgtgtgggagcgcgcgccg
cgcgtggcgcgcgtcttccaggaccccatggccggcacctgcgaagacctcaccatcgag
gagaacatggcgctggcccgccagcgcggcgcgggccggggcctgcgcggcgccgtgaag
gcgaccgaccgcgccctcttccgcgagcggctcgccacgctgggcctggggctggagaac
cgcctggcggaccgcatcggcctgctctcgggcgggcagcggcaggccgtgagcctgctc
atggccgcgctgcagccctcgcgcatcctgctgctggacgaacacaccgccgccctcgac
ccgcgcacggccgacttcgtgctgcagctcaccgcgcgcatcgtggccgagagccggctc
acggcgatgatggtcacgcacagcatgcggcaggcgctggacgtgggcgaccgcacggtg
atgctgcaccagggccaggtggtgctggacgtgtcgggcgaggagcgcagccgcctggac
gtgcccgacctgctgcgcatgttcgagaccgtgcgcggcgagaagctggcggacgacgcg
ctgctgctcggctga

DBGET integrated database retrieval system