KEGG   Acidovorax avenae: Acav_2120Help
Entry
Acav_2120         CDS       T01445                                 

Definition
(GenBank) inner-membrane translocator
  KO
K05832  putative ABC transport system permease protein
Organism
aaa  Acidovorax avenae
Module
aaa_M00247  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaa02000]
    Acav_2120
Transporters [BR:aaa02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative ABC transporter [MD:M00247] [OT]
    Acav_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ADX46032
UniProt: F0QAJ1
Position
complement(2366185..2367069)
Genome map
AA seq 294 aa AA seqDB search
MSLFSFLGAIEIGLIFSLVALGVFISFRLLRFPDLTVDGSFPLGGAVCAVLIAGGHGPAV
ATVAATAAGAAAGLVTGWLNVRLKIMDLLASILIMIALYSINLRIMGGPNVPLITEPTLF
TQLQPGGMADYVARPLLLAVMIVAAKLFMDWFFATEKGLAIRATGSNARMARAQGVNTGA
MVLLGMAVSNALVALAGALFAQTQGGADISMGIGTIVIGLAAVIVGESLLPSRRLAWATL
AVIVGAIVYRFFIAAALNSDFIGLKAQDLNLVTAVLVTIALVIPQLRRKRASRR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgttctctttcctgggcgccatcgagatcgggctgatcttcagcctcgtcgcg
ctgggcgtcttcatctcgttccgcctgctgcgctttcccgacctgacggtggacggcagt
ttcccgctgggcggcgccgtctgcgccgtgctgatcgcgggcggccacggcccggccgtg
gccacggtggccgcgacggccgcgggcgcggcggcgggcctcgtcacgggctggctcaac
gtgcgcctgaagatcatggacctgctcgccagcatcctgataatgattgcgctctattcg
atcaacctgcgcatcatgggcgggcccaacgtgcccctcatcaccgagcccacgctgttc
acgcagctccagccggggggcatggccgactacgtcgcgcggccgctgctgctggccgtg
atgatcgtggcggccaagctgttcatggactggttcttcgccaccgagaagggcctggcg
atccgcgccacgggctcgaacgcgcgcatggcgcgcgcccagggcgtgaacaccggcgcg
atggtgctgctgggcatggcggtatcgaacgcgctggtggcgctggccggcgcgctcttc
gcgcagacccagggcggcgccgacatctcgatgggcatcggcaccatcgtgatcgggctg
gcggcggtgatcgtgggcgagagcctcctgccctcgcggcggctggcctgggccacgctg
gcggtgatcgtgggcgcgatcgtgtaccgcttcttcatcgcggcggcgctcaacagcgat
ttcatcggcctgaaggcgcaggacctgaacctcgtcacggccgtgctggtgaccatcgcg
ctggtgatcccgcagctgcggcgcaagcgggcctcgcgccgttga

DBGET integrated database retrieval system