KEGG   Acidovorax avenae: Acav_2128Help
Entry
Acav_2128         CDS       T01445                                 

Definition
(GenBank) protein of unknown function DUF81
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ADX46040
UniProt: F0QAJ9
Position
2376339..2377163
Genome map
AA seq 274 aa AA seqDB search
MVYTLLIITGMVTGFLSGLLGVGGGFLMVPVFIVLLPLQFPLEMATLPQVAVATALAATV
PATASAVYAQYKRGALPIAWVKRLAPSAAMGAAVGAVAAGLVHGVWVALVFSLYAAYFGL
RMLRGAGASRAAVDASASPQLIQRISPRAIGGMIGMFSATAGVGGASLTIPYLLAQRDSI
EMRNAVAAGSAVGLSIALVGAFAFALGPTPEIAAMPGLLGLVCWTAAIAVAVPAAFLAPW
GVSVSHRLPTQRLKRAFGLVMLLGAVITVWKVFG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtggtctataccttgttgatcatcaccgggatggtgactggctttctgtccggcctgctc
ggcgttggcggggggtttctgatggtgcccgtgttcatcgtcctgcttcccttgcagttt
cccctggagatggcaacgcttccgcaagtggcggttgccacggcgctggccgccaccgtg
ccggcgacggccagcgccgtctatgcccaatacaagcgcggcgcattgcccatcgcctgg
gtgaagcgccttgcgccgtccgcggcgatgggtgccgccgtgggggccgttgccgccggc
ctggtacacggtgtgtgggtggccctggtattcagcctctacgccgcgtacttcggtctg
cgcatgctgcggggcgctggcgcctctcgtgcggccgtggatgcgtccgcgtctccgcag
ctgatacagcgcatttcgccgcgtgccatcggcgggatgatcggcatgttcagtgcgaca
gcgggcgtgggcggggcaagcttgacgatcccctatctgctggcgcagcgtgacagcata
gagatgcgcaatgccgtcgcggcggggagtgccgtgggtctctccatcgcgctcgtgggt
gcatttgcttttgcattgggccccaccccggagatcgcagcgatgccggggctgcttggc
ctggtgtgctggaccgccgccattgcggttgccgtaccggcagcgttcctcgcgccctgg
ggtgtttccgtctcgcatcgcttgcccacccagcgtttgaagcgggcgttcggactcgtg
atgctcctgggcgcggtgatcaccgtgtggaaggtcttcggttga

DBGET integrated database retrieval system