KEGG   Acidovorax avenae: Acav_2129Help
Entry
Acav_2129         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic
Motif
Other DBs
NCBI-ProteinID: ADX46041
UniProt: F0QAK0
Position
2377205..2378587
Genome map
AA seq 460 aa AA seqDB search
MERRAQWVGEASEGILLVERPDGTTELVAAIAGVVGWRSSALRCCDVAAREGLLGRLAVD
PLTDVLVYREDLHSRETTGIGPAVAHFRGQLASVHRLCGLSAMESDRHQDPVHGLVALHD
LFAHCAPAQLSVRGTEAGSQATRLLNGVCCLLFEVLALRMPCHPEEAVLARLRDDVDVVL
PRTPAGLVIRNTLAILLETVRTRDCLPEPCRLVNHDELACYLFMDASDWSSELGRYHFEN
ELGYMAGCFQALRRLMSLGRAPLTADTLLEIHDVAIGNAFRRVPTPMQERFQKGYRSRAV
SFPLIEGRNHTAAGLEEFLASPDAGTGWITIGEREEGGGLQLTANAKHSLDCGCKAADIL
AHYYRQLDRIDAGAPDAEEMRVAATVRCCQSLDRNHLFVDANIRTIGYLCLNKFLWDLGM
EPAVLEYPKVLDMCSVAQVVEAVRRGQQRFRQLQGTGRRP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggagcgccgcgcgcagtgggtcggcgaggcgagcgagggcatccttctggtcgagagg
ccggacggaacgaccgaactggtcgcggccatcgccggggtggtcggttggcgctcctct
gctctgcgctgctgcgacgtcgcggcgcgcgaaggcctgctggggcggctggcggttgac
ccactcaccgatgtcctggtgtaccgtgaggacctgcattcgcgggagacgaccgggatc
gggccggccgtcgcgcatttccgcgggcaattggcgtcggtgcatcgcctttgcggtctg
agcgccatggaaagcgatcgccaccaggaccccgtgcatggtctggttgcgttgcacgat
ctgttcgcacattgcgcgcctgcgcagctgagcgtgcggggaaccgaggccggatcgcaa
gccacacgcctgctcaatggcgtgtgctgtctgctcttcgaggttctggctttgcgaatg
ccgtgtcatccggaagaggcggtgctggcgcgtctgcgggatgacgtggatgtcgtgctt
ccacgcacgcccgccgggctggtgattcggaacaccctggcgatcctcctggaaactgtc
cgcacgcgggactgcttgccggagccttgccgcctcgtgaatcacgacgaactcgcctgc
tacctgttcatggatgcgagcgactggtcatccgaactggggcggtatcacttcgagaac
gagctggggtacatggccggatgctttcaggcactgcggcgtctcatgtcgctgggccgg
gctccgctgacggcggacactctcctcgagattcacgatgtcgcgatcggcaacgcattc
aggagggttccgactcccatgcaggagcgcttccagaaaggataccgttccagggccgtg
tcatttcccctgatcgagggccgcaaccacactgcggcgggcctggaagagtttctggca
tcgccggatgccggcacgggctggatcaccatcggggagcgcgaggagggtggtgggctg
cagctgacggcgaacgccaagcattcgctcgactgtgggtgtaaagcggcggacatcctg
gcccattactatcgccaactcgacagaatcgatgcgggcgcaccggacgccgaggagatg
cgagtcgccgcaacggtgcgttgctgccagagcctggatcgcaaccatctgttcgtggac
gccaatatccggaccatcgggtacctgtgcctgaacaagttcctgtgggatctcgggatg
gagcccgcggtgctggagtacccgaaggttctcgacatgtgctcggtggcgcaggtggtc
gaggcggtgcgtcgcgggcagcagaggtttcgccaactgcaagggacgggacggcggccc
tag

DBGET integrated database retrieval system