KEGG   Acidovorax avenae: Acav_2142Help
Entry
Acav_2142         CDS       T01445                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
  KO
K07486  transposase
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Acav_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEDD_Tnp_IS110 Transposase_20 FliT HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: ADX46054
UniProt: F0QAL3
Position
2391852..2392802
Genome map
AA seq 316 aa AA seqDB search
MSELVYVGIDIAKNSFEVAVTGELQTLNLANDEAGHAQLCQWLAPLAPRLILMEATGGYE
QDLALALAGAGLRVSVVNPRQARDFARCVGKLAKTDRIDAQALRSFASMLDAQGHQPRAL
ADDERRELTALVVRRRQLVTMLVSERQRLGVAHRKAKPSILAIMDAIAAQLHDVDDELKA
HVQTHHADLAKLLTSVKGVGPTTACTLLAQLPELGQLNRKQITALVGLAPMNRDSGTLRG
QRHIFGGRADVRRVLYVAALVGTRFNPVLKAFYAKLLAAGKAKKVALVACMHKLLVILNA
IARTRSPWRDDFAERL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactcgtctacgtgggcatcgatatcgccaagaacagcttcgaagtggctgtc
acgggcgaactgcagacgctcaatctggccaacgacgaagccggccatgcccagctgtgc
caatggctcgcaccgctggcgcccaggctcatcctgatggaggccaccggcggctatgag
caagacctcgcgctggccttggcgggcgcgggcttgcgcgtgtcggtggtcaaccctcgc
caggcacgcgacttcgcgcgctgcgtgggcaagctggccaagaccgaccgcatcgacgcg
caagctctgcgcagctttgcctcgatgctcgatgcgcaaggccaccagcctcgtgccctg
gccgacgacgagcgccgcgagctcacggccctggtggtgcgccgcaggcaactggtgacc
atgctggtgtccgagcgccagcgcctgggcgtggcccaccgcaaggccaagcccagcatc
ctggcgatcatggatgccatcgcggcgcaattgcacgatgtcgatgacgagctcaaggcg
catgtccagactcaccacgccgacctggccaaactgctgacctcggtcaagggcgtgggg
ccgacgaccgcctgcacgttgctggcgcaacttcccgaactcggccagctcaatcgcaag
cagatcacggccctggtcggtctggcgcccatgaaccgagactcgggcacgctcaggggc
cagcgccacatcttcggtggccgcgccgacgtgcggcgcgtgctctacgtcgcagccttg
gtcggcacgcgcttcaaccccgtcctcaaggcgttctacgccaagctgctggccgcgggc
aaagccaagaaggtcgccctcgtggcctgcatgcacaagctgttggtcatcctgaacgcg
atcgctcgcaccaggtcgccctggcgcgatgactttgctgagcgtctttga

DBGET integrated database retrieval system