KEGG   Acidovorax avenae: Acav_2145Help
Entry
Acav_2145         CDS       T01445                                 

Definition
(GenBank) amidohydrolase 2
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ADX46057
UniProt: F0QAL6
Position
2394826..2395749
Genome map
AA seq 307 aa AA seqDB search
MTLAMARDDRTATPVRFSAGTTAPRTALPAGACDCHVHLYDSRFPAEPAARLRPPDAGVD
DLRALQRRIGSTRAVLVTPSTYGTDNRCMLEGLAALGADARGVAVIGGHESDAELLRLHE
AGVRGVRLNLSLGVSGTVDALLPLARRIAPLGWHLQLLMAPDLLAQQAGVLRQLPAPLVF
DHFGRIPPALAGRHPAHPLLLELLQEGRAWMKLSGGYIVSERHAVDDPALDALAAGYLRA
APERVVWGSDWPHATATAGVQPLPDDAGQVDRLAEWAELTGDAGTLRRVLVDNPAALYGF
PAVQTAR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgccatggcccgcgacgaccgcaccgccacgcccgtgcgcttctctgctggt
accaccgcgccgcgcacggcgcttccggccggtgcgtgcgattgccacgtccacctctat
gacagccgcttcccggccgagcccgccgcccgtctgaggcccccggacgcgggcgtggat
gacctgcgcgcgctgcagcggcgcatcggcagcacgcgcgccgtgctggtcacgccctcc
acctatggcaccgacaaccgctgcatgctggaaggattggccgcgctgggcgccgatgcc
cggggcgtggcggtgatcggcggccacgagagtgatgccgaactgctgcgcctgcacgag
gccggtgtgcgcggcgtgcggctcaacctgtcgctgggcgtgtcgggcacggtggatgca
ctgcttccgctggcacggcgcatcgcgccgctcggctggcatctgcaactgctgatggcg
ccggatttgctggcgcagcaggccggcgtgctgcgccagttgccagcgccgctggtgttc
gaccacttcgggcgcattccacccgcgctcgccggccgccaccccgcccatccgctgctg
ctggaattgctgcaggaagggcgcgcctggatgaagctctccggcggctacatcgtgagc
gagcgtcacgcggtggacgacccggcgctggatgcgctggccgccggctacctgcgcgcg
gcgccggaacgcgtggtctggggcagcgactggccccatgccaccgccacggccggcgtg
cagccgctgccggacgacgcggggcaggtcgaccgcctggccgaatgggcggagctgacc
ggagatgccggcacgctgcggcgcgtgctggtggacaacccggcggcgctctacggcttt
ccggccgttcagaccgcgcgctga

DBGET integrated database retrieval system