KEGG   Acidovorax avenae: Acav_2146Help
Entry
Acav_2146         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ADX46058
UniProt: F0QAL7
Position
2395783..2396814
Genome map
AA seq 343 aa AA seqDB search
MTDTLRPPTSPLGDAGIGRRGLIASAGTLLLGSLGPVPAYAQSDWPADKIITWVVPYPPG
GSTDVLGRTVAQRLGTALGTNVIVDNRAGATGTIGAAFVAKAAPDGYTLLGTSIGPQAIA
PHLLGKLPYDPIAAFEPVVIIGTIPHILVVGADQPFKTVADLVAAARAQPGQLAYASGGN
GTILQMQGELLQQQTGARFIHVPYKGDTPALQDTLAGQVQFMFAPVAAALPHVQAGKLRA
LAVTSAQRLKALPAVPTMGEVGMKDFVVEQWQAVFAPAKTPAALVQRLNQEINKALKDPA
VVALADKLGVTLVGGTPKQLGDLQKADSAKWAKVIQDGNIKAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccctccgtccaccgacatctcccctcggcgacgccggcatcggccgccgc
ggcctgatcgcctccgcggggacgctgctgctgggctctctgggcccggtgcccgcgtac
gcgcaatccgactggcccgccgacaagatcatcacctgggtcgtgccgtaccccccgggc
ggcagcaccgacgtgctgggccgcaccgtggcccagcgcctgggcacggctctgggcacc
aacgtgatcgtggacaaccgcgcgggcgccacaggcaccatcggcgccgccttcgtggcc
aaggccgcccccgatggatatacgctgctcggcacctcgatcggcccgcaggccatcgcg
ccgcacctcctgggcaagctgccatacgaccccatcgcagcgttcgagcccgtggtgatc
atcggcaccatcccgcacatcctggtggtgggcgcggaccagcccttcaagaccgtggcc
gatctcgtggccgcagccagggcccagcccggccagttggcctacgcctccggcggcaac
ggcaccatcctgcagatgcagggtgaactgctgcagcagcagacgggcgcgcgcttcatt
cacgtgccgtacaagggcgacacgcccgccctgcaggacacgctggcgggccaggtgcag
ttcatgttcgcgcccgtggccgctgcgctgccgcacgtgcaggccggcaagctgcgtgca
ctggccgtcacctcggcgcagcggctcaaggcgctacccgccgtgcccaccatgggcgag
gtcggcatgaaggatttcgtggtcgaacagtggcaggccgttttcgcgcctgccaagacg
cccgccgccttggtgcagcgcctgaaccaggaaatcaacaaggccctcaaggacccggcc
gtcgtggccctggccgacaagctgggcgtgacgctggtcggcggcacgccgaagcagctg
ggcgaccttcagaaggccgactccgccaagtgggcgaaggtcatccaggacggaaacatc
aaagcggaataa

DBGET integrated database retrieval system