KEGG   Acidovorax avenae: Acav_2148Help
Entry
Acav_2148         CDS       T01445                                 

Definition
(GenBank) Phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
aaa  Acidovorax avenae
Pathway
aaa00260  Glycine, serine and threonine metabolism
aaa00680  Methane metabolism
aaa01100  Metabolic pathways
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
aaa01230  Biosynthesis of amino acids
Module
aaa_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Acav_2148
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_2148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaa04147]
    Acav_2148
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Acav_2148
    1.1.1.399  2-oxoglutarate reductase
     Acav_2148
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acav_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADX46060
UniProt: F0QAL9
Position
2397542..2398474
Genome map
AA seq 310 aa AA seqDB search
MSAGTIIVTGADLAQQALDLLKNFEVVYAGKTPTEDDMVALAGQHDPVAIIVRYGKVGPA
VMDAAPSLKVISKHGSGTDTIDKVAAKARGIEVVAAVGANAAAVAEQALALLLACAKSVV
ELDARMHAGHWDKATHKSLELGGRTVGLVGLGAIGLRFAKMADALGMRVIGFDPFAKNLP
DYVQSVPLETLWRESDAVSLHCPLTEENRGMLNASTLAQCKRGVIVVNTARGGLIDEVAL
LEAVRSRQVMAAGLDSFAVEPMAPGHPFQGEPRFILSPHIGGVTSDAYVNMGVGAARNLL
AVLERAAAAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccggcaccatcatcgtcacgggggccgacctggcgcagcaggcgctcgatctg
ctgaagaatttcgaggtcgtgtacgccggcaagacgccgacggaagacgacatggtcgcc
ctggccgggcaacatgaccccgtggccatcatcgtgcgctacggcaaggtgggcccggcc
gtgatggacgcggcaccttcgctcaaggtgatctccaagcatggcagcggcaccgatacc
atcgacaaggtggcggcgaaagcgcgcggcatcgaggtggtggccgccgtgggtgccaac
gccgccgcggtggccgagcaggcactggcgctgctgctggcctgcgccaagtccgtggtg
gaactggatgcccgcatgcatgccggccactgggacaaggccacgcacaagagcctggag
ctgggcggccgcacggtgggcctggtgggcctgggcgccatcggcctgcgcttcgcgaag
atggccgatgcgctcggcatgcgcgtgatcggcttcgacccgttcgcgaagaatctgccg
gactacgtgcagagcgtgccgctcgaaaccctctggcgcgagtcggatgcggtgtcgctg
cattgcccgctgacggaagagaaccgcggcatgctgaacgccagcacgctggcgcagtgc
aagcgcggcgtgatcgtggtgaacaccgcgcgtggcggcctgatcgacgaggtggcgctg
ctggaggccgtgcggtcccgccaggtgatggcagcggggctggacagcttcgccgtcgag
cccatggcgcccggccatccattccagggcgaaccgcgcttcatcctgagcccgcacatc
ggcggcgtgacaagcgacgcctacgtgaacatgggcgtgggtgcggcccgcaacctgctg
gccgtgctggagcgcgctgccgcggcggcctga

DBGET integrated database retrieval system