KEGG   Acidovorax avenae: Acav_2152Help
Entry
Acav_2152         CDS       T01445                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region-containing protein
  KO
K01053  gluconolactonase [EC:3.1.1.17]
Organism
aaa  Acidovorax avenae
Pathway
aaa00030  Pentose phosphate pathway
aaa00053  Ascorbate and aldarate metabolism
aaa00930  Caprolactam degradation
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
aaa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acav_2152
   00053 Ascorbate and aldarate metabolism
    Acav_2152
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Acav_2152
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.17  gluconolactonase
     Acav_2152
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Acav_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL NHL Str_synth PQQ_2 Lactonase
Motif
Other DBs
NCBI-ProteinID: ADX46064
UniProt: F0QAM3
Position
2401738..2402667
Genome map
AA seq 309 aa AA seqDB search
MFLLQAPQIRDLETFTAMPASLRRPERSDWADANRGGTVTDSFLEGPVFDDAGHLYVSDI
PWGRIFRIDPQGAWSLVAEYDGEPNGMKFLDAGTLLITDYKNGLMRLDVATGRVSPYLQR
RNSERFKGVNDLVFDAEGNLYFTDQGQSGLHDPSGRLYRLRTNGQLDLLLHNVPSPNGVA
LSPDGRVLYLAVTRGNCVWRVPLLPDGSVAKVSQFFTSYGPSGPDGLAVDRQGRVLVANP
GLGVVWILNGRAEPEWVLRGIPGSSTTNLAFGGEDRRTLYVTDSTHGRILRTTMESPGLP
LHRAIAGPR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgctgcaagccccccagatccgtgacctggaaaccttcacggccatgcccgca
tccctgcgccgccccgagcgcagcgactgggccgacgccaatcgcggcggcaccgtcacc
gactcgttcctcgaaggtccggtgttcgacgacgcgggccacctgtatgtgagcgacatc
ccctggggccgcatcttccgcatcgacccgcagggcgcctggagcctcgtggccgaatac
gacggcgagcccaacggcatgaagttcctcgatgccggcacgctgctcatcaccgactac
aagaacggactgatgcgcctcgacgtcgccaccggccgtgtgtcgccgtacctgcagcgc
cgcaacagcgagcgcttcaagggcgtgaacgacctggtcttcgatgcggaaggcaatctc
tacttcaccgaccaggggcagagcgggctgcatgatccttccgggcgcctctaccgcctg
cgcaccaacggccagctcgatctgctgctgcacaacgtgcccagtcccaacggcgttgcg
ctctcgcccgacggccgcgtgctgtacctggcggtcacgcgcggcaactgcgtctggcgc
gttccgctgctgcccgacggcagcgtggccaaggtgagccagttcttcacgtcctacggc
cccagcggcccggatggcctcgccgtggacaggcagggtcgggtgctcgtcgcgaacccg
ggcctgggcgtggtgtggatactcaacgggcgtgccgaacccgaatgggtgctgcgcggc
attcccggcagctccaccaccaaccttgccttcggcggcgaggaccggcgcacgctctac
gtgacggattccacgcacggccgcatcctgcgcaccaccatggagtcgcccggcttgccg
ctgcaccgggcgatcgccggaccgcgctga

DBGET integrated database retrieval system