KEGG   Acidovorax avenae: Acav_2155Help
Entry
Acav_2155         CDS       T01445                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03885  NADH dehydrogenase [EC:1.6.99.3]
Organism
aaa  Acidovorax avenae
Pathway
aaa00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Acav_2155
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     Acav_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_9 DAO Lycopene_cycl NAD_binding_8 Amino_oxidase Thi4
Motif
Other DBs
NCBI-ProteinID: ADX46067
UniProt: F0QAM6
Position
2406863..2408143
Genome map
AA seq 426 aa AA seqDB search
MHSDIVIVGGGAGGLELAARLGRSLGAKQGRERVLLVDRSPFHIWKPTLHEVAAGTLDAH
QEGLSYPVLARRNHFGFAIGDLVGLDTARKTIELGEIRNAEGELLVPRRTVSYTRLVLAI
GSGSNAFGTPGIEHAYLLENVRDAQRFHTDWLGACARASFSESRALSIAIVGAGATGVEL
SAELLEAYAELLESLGSSQRFRLDITLVEGGSRILGGLPEKISAQAEVALRRKQVQVLTG
TRVTEIRRGALVTPNGEIPADMVVWAAGIKAAEGNARLGLEVNRLNQFIVDDRLRTSAPD
VLAFGDCAACPWVDGKTVPARAQAAHQQADYLAKVLGALLREQEVAAPFVYKDFGSLVSL
GDNKGVGNLMGGLGGRNFFVEGLIAKWMYISLHLNHHRAILGTGKTVVLALARLLQQRVS
GRLKLH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgacatcgtgatcgtgggcggcggggccggcgggctggaactggcagcgcgc
ctcgggcgcagcctcggtgcgaagcagggccgcgaacgcgtgctgctggtggaccgttcg
cctttccacatctggaagcccaccctgcacgaggtggccgccggcacgctggacgcccac
caggaaggactgtcctaccccgtgctggcacggcgcaaccatttcggcttcgccatcggc
gacctggtggggctggacacggcgcgcaagaccatcgagctgggcgagatccgcaacgcc
gagggcgagctgctggtgccgcgccgcacggtgagctacacccgcctggtgctggccatc
ggcagtggctccaacgctttcggcacgcccggcatcgagcatgcctacctgctcgagaac
gtgcgcgatgcgcagcgcttccataccgactggctgggcgcctgcgcgcgggcctcgttt
tccgaaagccgggcactgtcgatcgccatcgtgggcgcgggcgcgacgggcgtggagctg
tccgcggaattgctggaagcctatgccgaactgctcgaaagcctgggcagcagccagcgc
tttcgcctggacatcaccctggtcgaaggtggcagccgcatcctgggcggcctgcccgag
aagatttccgcgcaggccgaagtggcgctgcggcgcaagcaggtgcaggtgctcaccggc
acgcgcgtgaccgagatccgccgtggcgccctggtcacccccaacggagagattcctgcg
gacatggtggtctgggccgccggcatcaaggcggcggagggcaatgcccgcctgggcctg
gaggtgaaccggctcaaccagttcatcgtggacgaccgcctgcgtacctcggcgcccgac
gtgctggccttcggcgactgcgccgcctgcccgtgggtcgatggcaagaccgtgcccgcc
cgcgcgcaggccgcgcaccagcaggccgactacctggccaaggtgctgggcgcgctgctg
cgcgagcaggaagtggccgcgcccttcgtgtacaaggatttcggctccctggtctcgctg
ggcgacaacaagggcgtgggcaacctcatgggcgggctcggcgggcgcaacttcttcgtc
gaaggcctgatcgccaagtggatgtacatctccctgcacctgaaccaccaccgcgccatc
ctgggcaccggcaagacggtggtgctggccctggcacggctgctgcagcagcgcgtgtcc
ggccggctcaagctgcattga

DBGET integrated database retrieval system