KEGG   Acidovorax avenae: Acav_2163Help
Entry
Acav_2163         CDS       T01445                                 

Definition
(GenBank) nitrogen regulatory protein P-II
  KO
K04751  nitrogen regulatory protein P-II 1
Organism
aaa  Acidovorax avenae
Pathway
aaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acav_2163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P-II DUF3240 CdAMP_rec Nit_Regul_Hom DUF2344
Motif
Other DBs
NCBI-ProteinID: ADX46075
UniProt: F0QAN4
Position
2415270..2415608
Genome map
AA seq 112 aa AA seqDB search
MKMITAVIKPFKLEEVREALAECGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVK
VEVVVRSEDVDRCVDAIVTAARTGKIGDGKIFVTEVERVVRIRTGDLDDAAV
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgattaccgccgtcatcaagcccttcaagctcgaagaggtccgcgaggcgctg
gccgaatgcggcgtcaccggcctcacggtgacggaggtcaagggtttcggccggcagaag
ggccacaccgagctctaccgcggcgccgaatacgtggtggacttcctgcccaaggtgaag
gtggaggtcgtggtcaggagcgaggacgtggaccgctgcgtggatgcgatcgtcactgcg
gcgcgcaccgggaagatcggcgacggcaagatcttcgtaacggaagtcgagcgggtggtg
cgcatccgcacgggcgacctcgacgacgcggccgtctga

DBGET integrated database retrieval system