KEGG   Acidovorax avenae: Acav_2169Help
Entry
Acav_2169         CDS       T01445                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
aaa  Acidovorax avenae
Brite
Transcription machinery [BR:aaa03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Acav_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 Sigma70_r2 GerE HTH_28
Motif
Other DBs
NCBI-ProteinID: ADX46081
UniProt: F0QAP0
Position
complement(2418653..2419222)
Genome map
AA seq 189 aa AA seqDB search
MATEQELSDFLKSVEKRAFKRSLYHVRNEEAALDIVQDSMLKLAEHYGDKPPAELPMLFQ
RILSNCTLDWFRRQKTRNALFSNMSDFEGPGEDGDDFDLLEAYSGPEDRQTSQSAEDLVR
RAQVFRDIESEIQELPARQREAFLMRYWEEMDVAETAAAMGCSEGSVKTHCFRAIQTLSK
ALKARGIEL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaccgaacaggaactgtccgactttctcaaaagcgtggaaaagcgagccttcaag
cgctcgctctaccatgtgcgcaacgaggaagcggcattggacatcgtccaggacagcatg
ctcaagctggccgagcactatggggacaagccgcccgcggagctccccatgctgttccag
cgcatcctgtccaactgcaccctggactggttccggcgccagaagacccgcaatgcgctc
ttctcgaacatgagcgatttcgaggggccgggcgaggacggcgacgatttcgacctgctg
gaagcctattcgggtcccgaggaccggcagacgtcgcagagcgcggaagatctcgtgcgc
cgcgcccaggtcttccgggacatcgaatccgagatacaggagttgcccgcccgtcaacgg
gaggcgtttttgatgcgttactgggaagagatggatgttgcggaaacagcggcggccatg
ggctgctcggaaggcagcgtcaaaacccattgtttccgcgccatccagaccctcagcaag
gcactgaaggcacgaggaatcgaactatga

DBGET integrated database retrieval system