KEGG   Acidovorax avenae: Acav_2170Help
Entry
Acav_2170         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX46082
UniProt: F0QAP1
Position
complement(2419299..2419424)
Genome map
AA seq 41 aa AA seqDB search
MGEMMDAPDRDPFAFLNCRADYGTADLRGDAPGPKNITPMR
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaatgatggatgcgccggaccgggacccgtttgcctttttgaattgcagggcg
gattatggcactgccgacctgcgcggcgacgcgcccggtccaaaaaacatcacgccgatg
cgataa

DBGET integrated database retrieval system