KEGG   Acidovorax avenae: Acav_2178Help
Entry
Acav_2178         CDS       T01445                                 

Definition
(GenBank) Arginine-tRNA-protein transferase domain protein
  KO
K21420  leucyl-tRNA---protein transferase [EC:2.3.2.29]
Organism
aaa  Acidovorax avenae
Brite
Enzymes [BR:aaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.29  aspartate/glutamate leucyltransferase
     Acav_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATE_C ATE_N
Motif
Other DBs
NCBI-ProteinID: ADX46090
UniProt: F0QAP9
Position
complement(2427970..2428707)
Genome map
AA seq 245 aa AA seqDB search
MTQLNDLPLQTLQFYATAPYPCSYLPDRQARSQVATPSHLIQSDVYSDLVARGFRRSGMF
TYRPYCDGCQACTPLRVLAGEFRPDRSQRRAWKQHSGLQTRVLRLCYEPEHYQLYLHYQR
ARHSGGGMDHDSIDQYTQFLLQSRVNSRLVEFRDPAPDGETGTLRMVSILDVLDDGLSAV
YTFYDPDPDCSYGTFNVLWQIEQARTLGLPHVYLGYWIAESAKMNYKSRFHPHELRVHGE
WQRGG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaactcaacgaccttccgctgcagaccctgcagttctacgcgacggccccttac
ccgtgcagctacctgccggaccggcaggcccggtcccaggtcgccacgcccagccacctg
atccagagcgacgtgtattccgacctggtggcgcgcgggttccgccgcagcggcatgttc
acctaccgcccctattgcgacggctgccaggcctgcacgcctctgcgcgtgctggcgggt
gaattccggcccgaccgcagccagcgccgcgcctggaagcagcacagcggcctccagacc
cgcgtgctgcggttgtgctacgagccggagcactatcagctgtatctccactaccagcgc
gcccgccattccggcggcggcatggaccacgacagcatcgaccagtacacgcagttcctg
ctgcaaagccgcgtgaactcgcgactggtcgaattccgcgatccggcgcccgacggcgag
acaggcacgctgcgcatggtgtccatcctcgacgtgctggacgacggcctgtcggccgtc
tataccttctacgatcccgatccggactgcagctacggcaccttcaacgtgctctggcag
atcgagcaggcgcgcacgctcggcctgccgcacgtctacctggggtactggatcgccgag
agcgccaagatgaactacaagtcgcgcttccatccacacgaattgcgggtgcacggcgag
tggcagcgcggcggctga

DBGET integrated database retrieval system