KEGG   Acidovorax avenae: Acav_2192Help
Entry
Acav_2192         CDS       T01445                                 

Definition
(GenBank) methyltransferase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_33 Methyltransf_25 Methyltransf_12 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADX46104
UniProt: F0QBD9
Position
2446904..2447842
Genome map
AA seq 312 aa AA seqDB search
MNAHALQRSEPAHSDIIPGLLRHPACISPKYFYDERGSELFEEITRLPEYYPTRTEQAVM
ARHGEDIAQAVGAVETVIELGAGSCEKVQPLCRLLRPQRFVGVDISADFLRGAVARLQEA
LPWLRAEAVAGDLTRPVVLPQDVPRARRLVFYPGSSIGNFDPPQALALLSRMRGLVDRDG
GVLIGFDLPKDVAVLEAAYDDAAGVTAAFNRNALEHVNRLIGSDFVAQDWEHRAFFDRRL
SRIEMHLETPRGAHVRWPGGGRVFAPGERIHTENSYKYTLPAFQALLARAGFSRARVWTD
ERGWFAVAYARP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccatgccctccagcggtccgaacccgcccattccgacatcattcccgggctg
ctgcggcaccccgcctgtatttcgccgaagtatttctacgacgagcggggatcggagctc
ttcgaggagatcacccggctgccggagtactaccccacgcgcaccgaacaggccgtgatg
gcgcggcatggcgaagacatcgcgcaggcggtgggcgcggtcgagacggtgatcgagctg
ggggccggcagctgcgagaaggtgcagccgctgtgccgcctgctgcggccgcagcgtttc
gtgggggtggatatttccgcggatttcctgcgcggcgcggtggcacgtctgcaggaggcc
cttccctggctgcgggccgaggccgtggcgggcgacctcacgcggcccgtggtgctgccc
caggatgttccccgtgcccggcggctggtgttctacccgggctcctcgatcggcaacttc
gatccgccccaggcactggcgctgctgtcgcgcatgcgcggcctggtggaccgcgacggc
ggcgtgctcatcggattcgacctgcccaaggacgtggccgtgctcgaggctgcctacgac
gacgcggccggcgtgacggccgcgttcaaccgcaatgcgctggagcacgtgaaccggctc
atcggcagcgacttcgtggcgcaggactgggagcaccgcgccttcttcgaccggcgcctg
tcgcgcatcgagatgcacctggagacgccccgcggcgcccacgtgcgctggcctggcggc
gggcgcgtcttcgcgcccggcgagcgcatccataccgagaacagctacaagtacaccctg
ccggccttccaggccctgctggcgcgggcgggcttctcccgcgcgcgggtctggaccgac
gagcgcggatggttcgccgtggcctacgcgcggccctga

DBGET integrated database retrieval system