KEGG   Acidovorax avenae: Acav_2197Help
Entry
Acav_2197         CDS       T01445                                 

Definition
(GenBank) peptidase U32
  KO
K08303  putative protease [EC:3.4.-.-]
Organism
aaa  Acidovorax avenae
Brite
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     Acav_2197
Peptidases [BR:aaa01002]
 Peptidases of Unknown Catalytic Type
  Family U32
   Acav_2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U32 DUF3656
Motif
Other DBs
NCBI-ProteinID: ADX46109
UniProt: F0QBE4
Position
complement(2451283..2453292)
Genome map
AA seq 669 aa AA seqDB search
MSLLPHQLELLSPARDADIGIEAVNHGADAVYIGGPAFGARASAGNELRDLERLIRHAHR
FHSRIFVTLNTILRDDELEGARRMAWQVYEAGADALIIQDMGLLEIDLPPIQLHASTQTD
IRTPEKARFLQDAGLSQIVLARELTVQEIAAIRAATDPERCTIEFFIHGALCVAYSGQCY
ISHAHTGRSANRGDCSQACRLPYQVTDDAGRFIAHDKHVLSMKDNNQSANLRPLIDAGVR
SFKIEGRYKDMAYVKNVTAHYRRLLDEIIEERETSAAPLARSSSGQTRFTFTPDPNQNFN
REFTDYFVNGRKEDIGAFDTPKNPGQAIGWVTQVGPNWVELETHAPDTVLHNGDGLCYWD
LQKELVGVAINRAEAAPGKSRNHWRVFPKDPMEGFRDLRRGTEINRNRDMDWVRTLEKKS
SERRIGLWAHFTDTDSGFALTLTDEDGFTGTAEVAHAHEPATDAARAEGALREQIGRFGA
TIFHAHDIAIAMRQPWFVPASVLNPLRRDAVAALEAARSGGLQRLPRARPVEPPAPFPED
TLTYLANVFNQKAHDFYMKHGVKVIDAAYESQEEDGEVSLMITKHCVRFSMSLCPKQAKG
VIGVKGTIKAEPLHLINGKEKLTLRFDCKPCEMHVVGRIKKSVQNQQAREAQAVPMQFYR
TRPVPGAPH
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcctgccccaccagctcgaactgctctcccccgcccgcgacgccgacatcggc
atcgaggcggtcaaccatggcgcggatgccgtctatatcggcggaccggccttcggcgcg
cgggccagcgcgggcaacgaactgcgcgacctggagcggctcatccgccatgcgcaccgc
ttccacagccgcatcttcgtcacgctcaacaccatcctgcgcgacgacgagctcgaaggc
gcccgccgcatggcctggcaggtgtacgaggccggcgccgatgcgctcatcatccaggac
atgggcctgctggaaatcgacctgccccccatccagctacacgcgagcacccagacggac
atccgcacgcccgagaaggcgcgcttcctgcaggacgccgggctgtcgcagatcgtgctg
gcgcgggagctcacggtgcaggagatcgcggccatccgcgcggcgaccgacccggagcgc
tgcacgatcgagttcttcatccacggcgcgctctgcgtggcctacagcggccagtgctac
atcagccacgcgcacaccggccgcagcgccaaccgcggcgactgcagccaggcctgccgc
ctgccctaccaggtgacggacgacgccggccgcttcatcgcgcacgacaagcacgttctc
tcgatgaaggacaacaaccagtcggccaacctgcgccccctcatcgacgcaggggtgcgc
agcttcaagatcgaagggcgctacaaggacatggcctacgtgaagaacgtcacggcccac
taccgccggctgctggacgagatcatcgaggagcgcgagacctccgccgcccccctggcg
cgctcctccagcggccagacgcgcttcaccttcacgcccgacccgaaccagaacttcaac
cgcgagttcaccgactatttcgtgaacggccgcaaggaagacatcggcgccttcgacacg
cccaagaaccccggccaggcgatcggctgggtcacgcaggtgggcccgaactgggtcgaa
ctggaaacccacgcgcccgacacggtgctgcacaacggcgacggcctgtgctactgggac
ctgcagaaggagctcgtgggcgtggcgatcaaccgcgccgaggcggcacccggcaagtca
cgcaaccactggcgcgtgttcccgaaggacccgatggagggtttcagggacctgcgccgc
ggcaccgagatcaaccgcaaccgcgacatggactgggtgcgcacgctcgagaagaaatcc
agcgagcggcgcatcggcctgtgggcgcatttcaccgataccgattccggcttcgccctc
acgctgaccgacgaggacggcttcaccggcaccgccgaggtggcgcatgcgcacgagccg
gccaccgacgcggcgcgcgcggagggcgccctgcgcgagcagatcggccgcttcggcgcc
acgatcttccacgcgcacgacatcgccatcgcgatgcggcagccgtggttcgtgcccgcc
tccgtgctgaatccgctgcgccgcgatgccgtggccgccctggaggcggcgcgttccggg
ggcctgcagcgcctgccccgcgcgcgccccgtggagccgccggcgcccttccccgaggac
accctcacctacctggccaacgttttcaaccagaaggcgcacgacttctacatgaagcac
ggcgtgaaggtgatcgacgcggcctacgagagccaggaagaggacggcgaggtgagcctg
atgatcaccaagcactgcgtgcgcttttccatgagcctgtgtcccaagcaggccaagggc
gtgatcggggtcaagggcaccatcaaggccgagcccctgcacctgatcaacggcaaggaa
aaactcaccctgcgcttcgactgcaagccctgcgagatgcacgtggtgggccggatcaag
aaatcggtgcagaaccagcaggcgcgcgaggcgcaggcggtgccgatgcagttctaccgc
acgcggccggtgcccggcgcgccgcactga

DBGET integrated database retrieval system