KEGG   Acidovorax avenae: Acav_2198Help
Entry
Acav_2198         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX46110
UniProt: F0QBE5
Position
2453445..2454458
Genome map
AA seq 337 aa AA seqDB search
MRLSPLRSGSLPPTASLHGAPADGGLAAPGSEPAATPLRRSLSSPHLSPLSARDREAGIR
REAALAARFGSCQPARGKAKTGADGQVTYRSPIQKQELEPAQHGYRRVRINPTRVLIAEH
QGLETSTFFIRHQADLEAVRRVDRPADAAGMGAGPLQDLLRLDDLRAHRVQYKWDISANG
SLVIGEVLVGAPEEVRERVAAGLRKKAEDASRAPAAMQEKKQKKEKKEKDAAGNPEPDPR
QFMLGHVTLVGGALVAAPWQATRGLPQAHISGMLYARPDGTLCIDNDSGRFSEYEDRVPA
HLQSVADMFARLGLPVAVDWKPKAPIPLARPVPRAQG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctttcacctctccggtccggttctcttccacccactgcatcgctgcacggcgcc
cctgcggacggcgggctcgcggcgccaggctccgagcccgccgccacgcccttgcggcgc
tcgctgtcgtcgccgcacctgtctccgctgtcggcgcgtgatcgagaggccgggatacgc
cgcgaggccgctctggcggcccggttcggcagctgccagcccgcgcgggggaaggcaaaa
accggtgcggatggccaggtgacctaccgcagcccgatacagaagcaggaactcgaaccg
gcgcagcacggctatcgccgggtgcggatcaatccgacgcgggtgctcatcgccgagcac
cagggccttgaaaccagcacattcttcatccgccaccaggccgacctggaggcggtgcgg
cgcgtcgacaggccggcggatgcagcaggcatgggcgcgggccccctgcaggatctgctg
cgcctggatgacctgcgtgcccaccgggtgcagtacaagtgggacatctcggccaacggc
tcgctcgtcatcggcgaggtgctggtcggcgcccccgaggaggtgcgcgagcgtgtcgca
gccggtctccgcaagaaggccgaggatgcctcgcgggcgccggcggccatgcaggagaaa
aaacagaagaaggaaaagaaggagaaggacgccgccgggaatccggagcccgatccgcgc
cagttcatgctgggccacgtgacgctggtgggaggcgcgctcgtcgcggcgccatggcag
gccacgcgcggcctgccgcaggcgcatatcagcgggatgctgtatgcccgcccggacggc
acgctgtgcatcgacaacgattccggccgcttcagcgaatacgaagaccgcgtgcccgcg
cacctgcaatcggtggcggacatgttcgcgcggctcggcctgcccgtggccgtggattgg
aagccgaaggcacccatccccctggcccgtccggtgccgcgcgcccaggggtga

DBGET integrated database retrieval system