KEGG   Acidovorax avenae: Acav_2202Help
Entry
Acav_2202         CDS       T01445                                 

Definition
(GenBank) Muramoyltetrapeptide carboxypeptidase
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aaa01002]
    Acav_2202
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaa01011]
    Acav_2202
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     Acav_2202
Peptidases [BR:aaa01002]
 Serine Peptidases
  Family S66
   Acav_2202
Peptidoglycan biosynthesis and degradation proteins [BR:aaa01011]
 Precursor biosynthesis
  Carboxypeptidase
   Acav_2202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S66
Motif
Other DBs
NCBI-ProteinID: ADX46114
UniProt: F0QBE9
Position
2457768..2458754
Genome map
AA seq 328 aa AA seqDB search
MPEHDHDHSHCGHDHGPRHIYIYSPAGAVRDKAAFKRGVARLQAMGHEVEVDADALAVHT
RFAGDDATRLAAIHRAAASGADVALISRGGYGLTRILDGIRYKAVAKAVERGTQFVGLSD
FTAFQAALLAKTGAMTWAGPALVGDLGCEGEPDDIMLACLDDLLTGHGEGAGWRMHNEKP
AADGTPAVKDCYIRNATLWGGNLAMLCSLVGTPYLPQVKGGILFVEDVSEHPYRVERMLT
QLLHAGILAQQKAVVLGQFTGYQLAPHDKGFKLQTVVDWLRTRIKAPVLTNLPFGHVPTK
VLLPVGTPVSLSVEGRDALIYWGHAASH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaacacgatcacgaccattcgcattgcggccacgaccatggcccgcgccacatc
tacatctactcgccggccggtgccgtgcgcgacaaggccgcattcaagcgcggcgtcgcc
cgcctgcaggccatggggcacgaggtggaggtggatgcggatgcgctggccgtccatacc
cggttcgcgggtgacgacgccacccgcctcgctgccatccaccgcgccgccgcgagcggc
gccgacgtggcgctcatttcgcgcgggggctacgggctcacccgcatcctggacggcatc
cgctacaaggccgtggccaaggcggtggagcggggcacgcagttcgtcggcctgagcgac
ttcaccgccttccaggccgcgctgctcgcgaagacgggcgccatgacctgggccggtccg
gcactggtcggcgacctgggctgcgaaggcgagcccgacgacatcatgctggcctgcctg
gacgacctgctcaccggccatggcgagggcgcgggatggcgcatgcacaacgagaaaccc
gccgccgacggaacgcccgcggtgaaggactgctacatccgcaacgccacgctctggggc
ggcaacctcgccatgctctgctcgctggtgggcacgccctacctgccccaggtcaagggc
gggatcctgttcgtggaagacgtgagcgagcatccgtaccgtgtcgagcgcatgctcacg
caactgctgcatgccggcatcctcgcgcagcagaaggccgtcgtgctcggccagttcacc
ggctaccagctcgcgccgcacgacaagggcttcaagctgcagaccgtggtggactggctg
cgcacccgcatcaaggcgcccgtgctcaccaacctgccgttcggccacgtgcccaccaag
gtgctgctgccggtgggcacgccggtatccctctccgtggaggggcgcgacgccctgatc
tactggggccacgcggccagccactga

DBGET integrated database retrieval system