KEGG   Acidovorax avenae: Acav_2205Help
Entry
Acav_2205         CDS       T01445                                 

Definition
(GenBank) Acyl-CoA dehydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
aaa  Acidovorax avenae
Pathway
aaa00071  Fatty acid degradation
aaa00280  Valine, leucine and isoleucine degradation
aaa00410  beta-Alanine metabolism
aaa00640  Propanoate metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
aaa01212  Fatty acid metabolism
Module
aaa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Acav_2205
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Acav_2205
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acav_2205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Acav_2205
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     Acav_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ADX46117
UniProt: F0QBF2
Position
complement(2462416..2463690)
Genome map
AA seq 424 aa AA seqDB search
MDFDYSPKTRDLQARLLKFMDEHIYPSEAAYTAELAANTAADRRWTALDTIEQLKPKARA
AGLWNLFLPVDSAAASGYEGAGLTNQEYAPLAEIMGRVPWASEVFNCSAPDTGNMETIAR
YGSEENKARWLRPLLEGEIRSAFAMTEPDVASSDATNISTRIERQGDEYVINGRKWWISG
AADPRCKVFITMGKSDPEAPKHSQQSMVLVPADTPGIRILRPLNVLGYDDAPHGHVEMVF
ENVRVPASNILLGEGRGFEIAQGRLGPGRIHHCMRLIGLAERALELMCRRASARVAFGKT
VAQQTVTQERIAEARCKIDMARLLTLKAAWLMDVAGNKVAKTEIAMIKVVAPSMACQVID
WAMQVHGGGGMCDDFPLAYAYAGARTLRFADGPDEVHRNAIAKWELGKYSAYGRGAEVPV
TRGC
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgactactcccctaagacccgtgacctgcaggcgcgcctgctgaagttcatg
gacgagcatatctacccgtccgaagccgcctacaccgcggaactggccgccaacacggcc
gcggaccggcgctggacggcgctcgacaccatcgagcaactcaagcccaaagcccgcgcg
gccggcctctggaacctgttcctgccggtcgattccgccgcggcctccggctacgaaggc
gccgggctcaccaaccaggaatacgcgccgcttgccgagatcatgggccgcgtgccctgg
gccagcgaggtgttcaactgctccgcgcccgacaccggcaacatggagacgatcgcccgc
tacggcagcgaggagaacaaggcccgctggctgcgccccctgctggaaggcgagatccgc
tcggccttcgccatgaccgagcccgacgtggcctccagcgacgcgaccaacatatcgacc
cgcatcgagcgccagggcgacgagtacgtcatcaacggccgcaagtggtggatctccggc
gcggccgacccgcgctgcaaggtcttcatcaccatgggcaagagcgaccccgaggcgccc
aagcactcgcagcagagcatggtcctggtgcccgcggacacgcccggcatccgcatcctg
cgcccgctcaacgtgctgggctacgacgatgcgccccacggccacgtcgagatggtgttc
gagaacgtgcgcgtgccggccagcaacatcctgctgggcgaaggccgcggcttcgagatc
gcccagggccgcctgggccccggccgcatccaccactgcatgcgcctgatcggcctggcc
gagcgcgcgctggagctgatgtgccgccgcgcctccgcgcgcgtcgccttcggcaagacc
gtggcccagcagaccgtgacgcaggagcgcatcgccgaggcccgctgcaagatcgacatg
gcccgcctgctcacgctcaaggccgcctggctgatggacgtggccggcaacaaggtcgcc
aagaccgagatcgcgatgatcaaggtcgtcgcccccagcatggcctgccaggtaatcgac
tgggccatgcaggtgcacggcggcggcggcatgtgcgacgacttcccgctggcctatgcc
tatgccggcgcgcgcaccctgcgcttcgcggatggcccggacgaagtgcaccgcaacgcc
atcgcgaagtgggagctgggcaagtactcggcctatggccggggggccgaggtgccggtg
acgcgcggctgctga

DBGET integrated database retrieval system