KEGG   Acidovorax avenae: Acav_2207Help
Entry
Acav_2207         CDS       T01445                                 

Definition
(GenBank) transcriptional regulator, Crp/Fnr family
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
aaa  Acidovorax avenae
Pathway
aaa02020  Two-component system
aaa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acav_2207
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Acav_2207
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aaa03000]
    Acav_2207
Transcription factors [BR:aaa03000]
 Prokaryotic Type
  Helix-turn-helix
   CRP/FNR family
    Acav_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 GntR MarR_2 HTH_24 HTH_20
Motif
Other DBs
NCBI-ProteinID: ADX46119
UniProt: F0QBF4
Position
complement(2464897..2465616)
Genome map
AA seq 239 aa AA seqDB search
MDDPILTIEEREAINTGRWFSSLSPSLRHDILRCAYVKRFKDGGLIAARGDPPEEWIACA
KGAVRVSSTSISGKQITLTYVEPGIWFGDVSIFDGDRRTHDAYAHGDTTILCVAKADFRK
ILATHVEFYEAMLRLHARRIRQLYGLVEDLNTLPLRARLAKQLLHLVRSYGIPSLSQGDE
IRIGLQLAQEELAQLLGASRQRVNQELKAMEREDAIRIEPGGLVVRDRDVLMRIAEADH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccccattcttaccatcgaagaacgagaggcgatcaataccggtcgctggttt
tcctccctttccccttcgctgcggcacgacatactccgatgcgcctacgtcaaacgcttc
aaggatggcggcctgatcgccgcccgcggcgatccgcccgaggagtggatcgcctgcgcg
aagggcgccgtgcgcgtgagctccacgtcgatctccggcaagcagatcacgctgacgtat
gtcgagccgggcatctggttcggcgacgtgtcgatcttcgacggggaccggcgcacgcac
gatgcctacgcgcacggggacaccaccatcctctgcgtggccaaggcggatttccgcaag
atcctggccacgcacgtggagttctacgaagcgatgctgcgcctgcatgcgcggcgcatc
cgccagctctacggcctggtggaagacctcaacaccctgccgctgcgcgcgcggctggcc
aagcagctgctgcacctcgtgcgcagctacggcatccccagcctgtcgcagggcgacgag
atccgcatcggcctgcaactggcgcaggaagaactggcgcagctgctgggcgcatcgcgc
cagcgcgtgaaccaggagctgaaggccatggagcgcgaggacgccatccgcatcgagccg
ggcggcctcgtcgtgcgcgatcgtgacgtcctgatgcgcatcgccgaagccgaccactga

DBGET integrated database retrieval system