KEGG   Acidovorax avenae: Acav_2214Help
Entry
Acav_2214         CDS       T01445                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
aaa  Acidovorax avenae
Pathway
aaa00730  Thiamine metabolism
aaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Acav_2214
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     Acav_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO 3HCDH_N NAD_binding_2 NAD_binding_8 ApbA F420_oxidored Glyco_transf_4 NAD_Gly3P_dh_N Rossmann-like
Motif
Other DBs
NCBI-ProteinID: ADX46126
UniProt: F0QBG1
Position
complement(2472500..2473618)
Genome map
AA seq 372 aa AA seqDB search
MTALLSPHSSIAILGAGLMGRLLAAELARQGHAVEVYEAQGPDAQGAAARIAAAMLAPLA
ESAITEPGVVRMGHHALSRWPQLLAGLEWPVFFQQEGTLILWHRQDAAEAARLRGVLERT
ARTVPELPALQVLDSRQLQEAEPALQGQRFHQGLYLPGEGQLDNRQLLAALEHSMRDRGV
RVHWHSPRAPEDFTPGAAVQPDWVLDCRGLGARAQWSELRGVRGEVVRLHAPGVALRRPT
RLVHPRYPIYIAPKEDHIFVIGATEIESDDLSPASVRSTLELLSAAYAVHPGFAEARILE
IATQCRPTLPDNLPAVRRTAPRVLQVNGLYRHGFMISPAILDVVMECLNEGQSPLASRFD
LALDLEPAAALP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctgctgtccccgcattcctccatcgccatcctgggcgccggcctcatgggc
cggctgctggccgccgagctggcgcggcaggggcacgccgtggaggtgtacgaggcccag
ggcccggacgcccagggtgccgcagcccgcatcgccgccgccatgctcgcgccgctggcg
gaatccgccatcaccgaacccggcgtggtccgcatgggtcaccatgccctgtcgcgctgg
ccccagttgctggccggcctcgagtggcccgtgttcttccagcaggagggcaccctcatc
ctctggcaccgccaggatgccgccgaggccgcgcggctgcgcggcgtgctggagcgcacg
gcccgcaccgtgcccgaactgcccgccctgcaggtgctcgacagcaggcaattgcaggag
gcggagcccgccctccaggggcagcgcttccaccagggcctgtacctgcccggcgagggc
cagctcgacaaccggcaactgctcgcggccctggaacactccatgcgcgaccgcggcgtg
cgggtgcactggcacagcccgcgcgcgccggaagatttcacgccgggcgcggccgtccag
cccgactgggtgctggactgccggggcctgggcgcccgggcgcagtggtccgaactccgc
ggcgtgcgcggcgaggtggtccggctgcacgcgcccggcgtggcgttgcgccgccccacc
cggctggtgcacccgcgctatcccatctatatcgcccccaaagaggaccacatcttcgtg
atcggcgccaccgagatcgaatcggacgacctctcgcccgcgagcgtgcgctccaccctg
gaactgctgagcgcggcctatgccgtgcaccccggcttcgccgaggcccggatcctcgag
atcgccacgcagtgccgccccaccctgcccgacaacctgcccgcggtgcggcgcaccgcg
ccgcgcgtgctgcaggtgaacggcctgtaccggcacggcttcatgatttccccggccatc
ctggacgtggtgatggaatgcctgaacgaaggacaatcccccctcgcctcccgcttcgac
ctggcgctggacctcgaacccgccgccgcactgccatga

DBGET integrated database retrieval system