KEGG   Acidovorax avenae: Acav_2215Help
Entry
Acav_2215         CDS       T01445                                 

Definition
(GenBank) phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
aaa  Acidovorax avenae
Pathway
aaa00730  Thiamine metabolism
aaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Acav_2215
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     Acav_2215
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     Acav_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin PfkB HK Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADX46127
UniProt: F0QBG2
Position
2473858..2474757
Genome map
AA seq 299 aa AA seqDB search
MNSKPLEPRPAASAVEGSRYVRVLSIAGSDSGGGAGIQADLKTFAALGCYGMTAITAITA
QNTQGVRSIHGVPAAILRDQIDAVVEDIGVDAVKIGMLHAPEVAEVVADAIRRHALPHVV
LDPVMVATSGDRLIAPDTVRVLVEALFPLATVVTPNLDEAGMLLGRAIQDEGAMEAAAQE
LLGLGAPAVLLKGGHLPGDALVDVLAVQGLAQHLRLRSARIPTRNGHGTGCTLSSAIAAH
LALGSGLREAVAAAHAYVQAAITAGAPVRTGRGAGPLDHGHAPVAQRIQRDPAATGGAL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaagcctctcgaaccacggccggcggcgtccgccgtggaaggatcccgctac
gtgcgcgtcctgtccattgcagggtctgacagcgggggcggggcgggcatccaggccgac
ctgaagaccttcgccgccctgggctgctacggcatgaccgccatcacggccatcaccgcc
cagaacacgcagggcgtacgctccatccatggcgtgcccgccgccatcctgcgcgaccag
atcgacgcggtggtggaagacatcggcgtggacgccgtcaagatcggcatgctgcatgcc
cccgaggtcgccgaggtggtggccgatgcgatccgccggcacgcgctgccccacgtggtg
ctcgatcccgtcatggtggccaccagcggcgaccgcctcatcgcgccggacaccgtgcgc
gtgctggtggaggcgctgtttccgctggccacggtggtgacgccgaacctcgacgaggcg
ggcatgctgctgggccgtgcgatccaggacgagggcgccatggaggccgcggcgcaggaa
ctgctgggcctcggcgccccggccgtgctgctcaagggcggccacctgccgggcgacgcc
ctggtggacgtgctggccgtgcaggggctggcccagcacctgcgcctgcggtccgcgcgt
atcccgacgcgcaacggccatggcacgggctgcacgctgtcgtccgcgatcgccgcccac
ctggccctcggcagcggcctgcgcgaagcggtggctgccgcgcatgcctacgtgcaggcg
gcgatcacggccggtgcgccggtgcgcacgggccgcggcgccggcccgctcgaccatggg
cacgcgcccgtggcgcagcgcatccagcgcgatccggccgcgaccgggggtgccctgtga

DBGET integrated database retrieval system