KEGG   Acidovorax avenae: Acav_2217Help
Entry
Acav_2217         CDS       T01445                                 

Definition
(GenBank) Conserved hypothetical protein CHP03759, BMA0021 family
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX46129
UniProt: F0QBG4
Position
2478749..2479546
Genome map
AA seq 265 aa AA seqDB search
MSSIQQQPGDPLLEFRLAYLRAIAKSWYETDYRDRLLAQKDIQPQLAKDFGLKTIWPWLD
VSLERSDNPLDQTLWKPELTAGWIGLDDAFEIVFPEAPSDRAAEALASYYQLFPTLMGAT
ADITNEEHVPPGIVGGALPTGLGIPGGDPGSLLAFGGVVLRAIALAWQSKEFRDELLNPQ
CSDAAGLLSQWLGYNNPFNFSIRFTPNKALTWDAGKGHWNQLNPDGSKIKNRIVLNYPNA
PEARDFWPISLTSYNNTGSAYPFTC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagttccattcagcaacagcccggcgatcccttgctggagttccggctggcctatctg
cgcgccatcgccaaatcctggtacgagaccgactaccgcgaccgcctgctcgcgcagaag
gacatccagccgcagctcgccaaggacttcggcctgaagaccatctggccctggctcgac
gtgtccctggagcgcagcgacaacccgctcgaccagaccctgtggaagcccgagctgacc
gcgggctggatcggcctggacgacgccttcgagatcgtgttccccgaggcgccctccgac
cgggccgccgaggcgctggccagctactaccagctgttccccacgctcatgggcgcgacc
gccgacatcaccaacgaggagcacgtgccgcccggcatcgtgggcggcgcactgcccacc
ggcctgggcatcccgggcggagaccccggttccctgctggccttcggcggtgtggtgctg
cgcgccatcgcgctcgcctggcagtccaaggagttccgcgacgagctgctgaatccccag
tgcagcgatgcggccggcctgctgagccaatggctgggctacaacaaccccttcaacttc
tccatccggttcacgcccaacaaggcgctgacctgggatgccggcaaggggcactggaac
cagctcaacccggacggcagcaagatcaagaaccgcatcgtgctgaactatccgaacgca
ccggaagcccgcgatttctggccgatctcgctcacgtcgtacaacaacaccggcagcgcc
tacccgttcacctgctga

DBGET integrated database retrieval system