KEGG   Acidovorax avenae: Acav_2220Help
Entry
Acav_2220         CDS       T01445                                 

Definition
(GenBank) putative avirulence protein AvrRxo1
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zeta_toxin AAA_33
Motif
Other DBs
NCBI-ProteinID: ADX46132
UniProt: F0QBG7
Position
complement(2480878..2482122)
Genome map
AA seq 414 aa AA seqDB search
MTDRLSRRNSADSTPRPVTSNAASISRHETPPRPTSRPVHALPAGFPAPSQRSRSSSPSR
VRASLPAKVPETSGNRPAIRLPAAPRGSDEIFGLGELPPPGQSRWDYLAHPQNWRPERRQ
LHDRLIGDAKTAAQDFAEVIERGGHPPTLFALRGNTAAGKTRMATQTIPVLANALKESGG
AGCINPDIFKRSLAETPEGAKLTSAQVHAESCILADRLEDELRLQKTASGAAISMLVDKR
LAGAHEIDAYIKLAQQTGRKIELCDIDAPLEQSLMGVLQRKHEGDAPRPPYVAVANGFSA
VRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHDPQLYEAITDPQGA
RAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagactcagccggcgaaattcagcggattcaacgccccggcccgtgaccagc
aacgccgcttcgatcagccggcatgaaacgccaccgcgcccgacctcccgtccggtacat
gcgctgccagccggcttcccggcaccatcgcagagatcgcgcagttcatcgccttcacgg
gtcagggcctcactgccggcaaaagtgccggagacatcgggcaacaggcctgcgatccgt
ttgccggccgcacccagggggtcggacgagatcttcggcctgggggaactccctcctcct
ggccagtcccgatgggactatttggcccatcctcaaaactggcgccccgagcggcgtcaa
ttgcatgaccggctgatcggcgatgcgaaaactgcagcccaggatttcgccgaggtgatc
gagcgcggtggccacccaccgacattgttcgcgttgcgaggcaatacggctgcgggaaag
acacgcatggcgacacaaaccatccccgtactcgccaatgccctcaaggagagtggcggc
gccggctgtattaatcccgacatcttcaaacgttcgctcgcagaaactccagagggagca
aaacttacctcggcgcaggtacacgccgagtcgtgcatcctcgctgaccggcttgaagac
gaactccgattgcagaagaccgcgagcggcgcggcgatcagcatgctggtcgataagcga
ctggctggagcgcacgaaatcgacgcgtacatcaagctggctcagcagaccggtcgcaaa
atcgagttgtgcgatattgatgctccactcgagcagtcactcatgggcgtgctgcagcgc
aagcacgaaggtgacgccccccggccaccctacgttgcggttgccaacggattctcggcg
gttcgcgggcaccggctcgatgtcatcgacaagtttctctcgaacccgaccttggggagc
tatcatctattcggcactaccgggaatggcagcaaggcgatggttgccagcgtcgtcaac
ggtgaactgagcattcatgaccctcagttatacgaggccattacagatccccaaggtgcc
cgggcaggcgatagcggcgatcagatcattgacgctgcgctgatcgaccggctgaccaaa
ggtatagacgacccagcgcgagccatggatgcccgcaccgcattggagcggtacgcgggc
atgacgtggtcggacgctctggccgcccatagttcactgacttga

DBGET integrated database retrieval system