KEGG   Acidovorax avenae: Acav_2221Help
Entry
Acav_2221         CDS       T01445                                 

Definition
(GenBank) bacteriocin biosynthesis cyclodehydratase domain protein
  KO
K09136  ribosomal protein S12 methylthiotransferase accessory factor
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aaa03009]
    Acav_2221
Ribosome biogenesis [BR:aaa03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Acav_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YcaO
Motif
Other DBs
NCBI-ProteinID: ADX46133
UniProt: F0QBG8
Position
2482383..2484587
Genome map
AA seq 734 aa AA seqDB search
MDWFHTVPCWHPRFRAVQRPAALSATSIPSAPILVEEVGAFFLPFAESAILAHLVDGALA
PAAWCAAGGDPRHLPGLLSAMEALARRGDLFARGAAPGGWAVPRVDAAPVHEEGDAGSVT
WLVEPGALPAWRAAVDAAGGGAMAEVDLVLCEDYFDPRLAGEWERALQADRSRWWLPVRL
GGAQSIAGPLLRPGGSGPCWHCFLHRLRRNSPGRAWLEREVPGSHGLVPLFSDPAGRALR
WRQAQEAACRLLADAVPGRFAVLGNPQAPAGGEGDPEAWEAAPRRPQCPQCGDVGWMERQ
ARQPVQLRDVQTLPGARGGSRTVPPEATVQAVQSSVGAWAGVVTECSPLPLAEAGAITVY
RSAFHPAGPQEGGPVAARWCLGKGMTAAQAQASALCEAVERYAAGFQGDEAWTEACEDAL
PAPAFGPRSLVFVSDRQRARCGPGDDRVRRTLAHPAGAPLAWTPAWSLTRGAPCFLPLAH
CYAGVPERWSRYGEWNSNGCAAGNCVEEAVLQGLLEVVERDATAIWWYNELAMPAFDLGR
ADPEHVGRVRSTLGSGWSFWALDLTHDVGIPVVAAVGRHADGDWALGFGCSLGADMACER
ALTELVQLVAVGKTLPGHWNGLRSASPQFLLPEGGDNHGIASSVRACAATGRRGGIREDI
AACVEAARRCGLEVVVHDYSRPDLPLRTVKTTLPGACHIWPELANPRLSRVPVAMGWRDA
AWDEGDLNPWPLYV
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggattggtttcataccgtgccttgctggcacccccgcttccgcgcggtgcagcgccct
gcggccctgtccgccacgtccatcccctccgccccgatcctggtcgaggaggtaggcgcg
ttttttctgcccttcgcggagtcggccatcctcgcgcatctggtggacggtgcactggcc
cccgcggcctggtgcgcggccggtggcgatccgcggcacctgcccggcctgctgtcggcg
atggaggcgctggcgcgccgcggtgatctgttcgcgcgcggtgcagctcccggtggctgg
gccgttccccgcgtggatgccgcgccggtgcatgaagagggcgacgccggcagcgtgacc
tggctggtggagcccggcgcgctgcctgcctggcgtgctgcggtggatgccgctggtgga
ggcgccatggcggaagtggacctcgtgttgtgcgaagactatttcgatccccggctggcg
ggggagtgggagcgcgctctccaggcggaccggtcgcgctggtggctacccgtgcgcctg
ggcggcgcgcagtccatcgccggccccctgctgcgcccgggcgggtccgggccgtgctgg
cactgcttcctgcaccgcctgcggcgcaacagtccagggcgcgcctggctggagcgggag
gttccgggctcgcacgggctggtgcccctgttcagcgacccggcgggccgggcgctgcgc
tggcgccaggcgcaggaagccgcgtgccgcctgctggccgatgccgtgcccgggcggttc
gccgtgctcggcaacccccaggcgccggccggaggtgagggtgatccggaagcatgggag
gcggcgccgcggcggccccaatgcccgcagtgcggggatgtcgggtggatggagcgacag
gcccggcagcccgtgcagttgcgtgatgtgcagaccttgccgggcgcgcggggcggctcc
cgcacggtaccgcctgaagccacggtccaggccgtgcagtcctccgtcggcgcgtgggcc
ggcgtggtgacggagtgctcgccgctgcccctggcggaagccggtgccatcacggtctat
cgcagtgccttccatccggccggcccgcaggaaggcggcccggtggcggcgcgctggtgc
ctcggcaagggcatgaccgccgcccaggcgcaggcgagtgcgctgtgcgaggcggtggag
cgctacgccgcgggtttccagggcgacgaagcctggaccgaggcgtgtgaagacgcgctg
cccgctcccgccttcgggccgcgctccctggtgttcgtgagcgaccggcagcgtgcgcga
tgcggcccgggggacgaccgcgtccggcgcaccctggcccatcctgccggggcgccgctg
gcctggacccccgcctggtccctcacgcgcggggcgccgtgctttctgccgctcgcccac
tgttatgcgggcgtacccgagcgctggtcccgctacggcgagtggaactcgaacggctgc
gccgccggcaactgcgtggaggaggccgtcctgcagggcctgctggaggtggtcgagcgc
gatgccacggcgatctggtggtacaacgaactggccatgcccgcgttcgatctcggccgt
gcagacccggagcacgtcggccgcgtgcgctccacactcggcagtggctggagcttctgg
gcgctggacctgacccacgatgtcggcatcccggtggtggctgccgtgggccgccacgcc
gatggcgactgggcgctgggcttcgggtgcagcctgggcgccgacatggcctgcgagcgg
gccttgacggaactggtgcagctggtggcggtgggcaagaccctgcccgggcactggaac
ggcctgcgcagtgcatccccgcagttcctcctgccggaaggaggggataatcacggcatc
gcgtcttccgtccgcgcctgcgcggcaacgggccggcgcggcggcatccgtgaggacatc
gcggcctgcgtggaggcggcccggaggtgcggcctggaagtggtggtgcacgattactcg
cgcccggaccttccgctgcgcacggtcaagaccacgcttcccggcgcctgccatatctgg
ccggaactcgcgaatccccgcctgtcgcgcgtacccgtggcgatgggatggcgcgatgcc
gcgtgggacgagggcgacctcaacccctggcccctctacgtctga

DBGET integrated database retrieval system