KEGG   Acidovorax avenae: Acav_2223Help
Entry
Acav_2223         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX46135
UniProt: F0QBH0
Position
2485889..2486227
Genome map
AA seq 112 aa AA seqDB search
MRCITLSSGVQASSRRAAAGALWQPQTLWESYYQHVMGSAPEQGYLSAFWRHYHGSCAEM
HVHGQDLLRWSSECDGVLCRLPYTPLSDFLRELKALCTHAHRVGAAVQVIAD
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgcatcaccctctcttccggcgtgcaggcctcttcccggcgcgcagcggcgggt
gccttgtggcagccgcagaccctgtgggagtcctattaccagcacgtgatgggctcggcg
cccgaacaaggctacctgtccgccttctggcgccactaccacggcagctgcgccgaaatg
cacgtgcacgggcaggatctgctgcgctggagcagcgagtgcgatggcgtactgtgccgg
ctgccctatacgccgctgagcgatttcctccgggagctcaaggcgctctgcacgcatgcc
caccgcgtgggcgcggccgtgcaggtgattgcggattga

DBGET integrated database retrieval system