KEGG   Acidovorax avenae: Acav_2226Help
Entry
Acav_2226         CDS       T01445                                 

Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
aaa  Acidovorax avenae
Pathway
aaa00230  Purine metabolism
aaa00261  Monobactam biosynthesis
aaa00450  Selenocompound metabolism
aaa00920  Sulfur metabolism
aaa01100  Metabolic pathways
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
Module
aaa_M00176  Assimilatory sulfate reduction, sulfate => H2S
aaa_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Acav_2226
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Acav_2226
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Acav_2226
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Acav_2226
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Acav_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 SRPRB GTP_EFTU_D2
Motif
Other DBs
NCBI-ProteinID: ADX46138
UniProt: F0QBH3
Position
complement(2487926..2489275)
Genome map
AA seq 449 aa AA seqDB search
MAAKAATATSAGQNDHQSALRFITCGSVDDGKSTLIGRLLVDSRAVLQDHLAGVTRGGET
DLALLTDGLSAEREQGITIDVAYRYFATETRKFIIGDAPGHEQYTRNMVTAASSADAAVV
LVDATKLDWRDPQLALLPQTRRHSLLVHLLRVHSLVFAVNKLDAVDDPALAWRHIRAALE
TFARTAGIAVRATVPVSALKGWNVVDAQPGWCGYEGPSLLQILEQLPHTPADTGLALAFP
VQWVEKFSSSADTTQGRRVFWGRVAAGQVAPGTEVQVFPSGQLARVAQVLDHARQPHTVQ
AGTSAGIILDREVDVSRGDWILAAPTPAATAGADDFDTPAPVPAWPARREIRATVAWMDD
EPLVAGRVYWALHGHRWVKAKAQRVVHRLNIHTLAEEEAAQLEPNAIGHVDLLLQEALPA
APFGQARVLGSLILVDTASHRTAAAVLVN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagcagccacggccacttcggcaggccagaacgatcaccaatccgcactc
cgcttcatcacctgcggctcggtcgatgacggcaagagcacgctgatcgggcgcctgctg
gtggacagccgcgccgtgctgcaggaccacctggccggcgtgacgcgcggcggcgagacc
gatctggcgctgctcaccgacggcctctcggccgagcgcgagcagggcatcaccatcgac
gtggcctaccgctacttcgccaccgagacgcgcaagttcatcatcggcgatgcaccgggc
cacgagcagtacacccgcaacatggtcacggccgcctccagcgccgatgcggccgtggtg
ctggtcgatgccaccaagctcgactggcgcgacccgcagctggcgctgctgccgcagacg
cgccgccactccctgctggtgcacctgctgcgcgtgcattcgctggtgttcgccgtgaac
aagctcgacgcagtggacgaccccgccctcgcatggcgccacatccgggccgcgctggaa
accttcgcccggacggccggcatcgccgtgcgcgccaccgtgcccgtgtccgcgctcaag
ggatggaacgtggtcgatgcgcagcccggctggtgcggctacgaaggcccgagcctgctg
cagatcctggagcagctgccccatacgcccgccgacaccggactggccctggccttcccg
gtgcagtgggtggagaaattctcgtcctcggcagacaccacgcagggccgccgcgtgttc
tggggccgcgtcgccgcgggccaggtcgcgcccggcacggaagtgcaggtgttcccgagc
ggccagctcgcccgcgtggcacaggtgctcgaccacgcccgccaaccgcacaccgtgcag
gccggcaccagcgcgggcatcatcctcgaccgcgaagtggacgtctcgcgcggcgactgg
atactggctgcgcccacccccgcggcaacggccggcgcggacgatttcgacaccccggcg
ccggtgcccgcctggccggcgcgccgcgagatccgcgccaccgtggcctggatggacgac
gagcccctggtggccggccgcgtgtattgggcactgcacggccaccgctgggtcaaggcc
aaggcgcagcgcgtggtgcaccgcctgaacatccacacgctggccgaggaagaggcggcg
cagctggagcccaacgccatcggccacgtggacctgctgctgcaggaagccctgcccgcc
gcgccgttcggccaggcccgcgtgctgggttccctgatcctcgtggacaccgcgagccac
cgcaccgccgcagccgtgctggttaactga

DBGET integrated database retrieval system