KEGG   Acidovorax avenae: Acav_3137Help
Entry
Acav_3137         CDS       T01445                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
aaa  Acidovorax avenae
Pathway
aaa00500  Starch and sucrose metabolism
aaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acav_3137
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Acav_3137
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Acav_3137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ADX47039
UniProt: F0Q7G6
Position
3568725..3572153
Genome map
AA seq 1142 aa AA seqDB search
MNAPLLRQPLPAADPSAGPLPEPGPVVMPETPEIDTQGDPQWYRDAVIYQLNVKAFFDSN
NDGYGDFKGVTAKLDYVKDLGVNTIWLMPFYPSPLRDDGYDIADYEDVHPQYGTLADFKE
MLDAAHERGLRVITELVINHTSSDHPWFQRARRAPPGSPERDFYVWSDTDQIYQGTRIIF
TDTETSNWAWDPVAKQYYWHRFFSHQPDLNFDNPLVLEAVFKTMRFWLDMGVDGFRLDAI
PYLVERDGTSNENLPETHAVIKKLRAAIDAEYGNRFLLAEANMWPEDVREYFGNGDECHM
AYHFPLMPRMYMAIAQEDRHPIVEILQQTPDIPEGCQWAIFLRNHDELTLEMVTSKERDY
MYSMYAADMRARINLGIRRRLAPLMENDLDRVKLMNGMLLSMPGSPIIYYGDEIGMGDNV
FVGDRNGVRTPMQWSPDRNGGFSRSDPQRLYLQPIMDAVYGYEALNVEAQSGDHSSLLHW
TRRMLAVRKTSRAFGRGRRTFLKPGNRKILAYVSEHEDDVILTVFNLSRAAQPVELDLSA
YRGRTPIEMLGRVTFPPIGDLPYLLTLHSYGFYWFRLSNEAPVPSWHQEGLDLQERPVLV
LFDGWTSFFRERVMPWRIGMAERMRTQFEDDTLPRFIELQRWYADKGAAIAGARILDHTV
WKAGEGCEWMLPLLGVEPAAKPGQPQGTAATYFVPLALAWEEGSEERMRRISPAGVARVR
QQAQVGVMGDAFHDESFCRAVVRAMGEGTELATDQGGRVRFRRTSAFDALAADLDALPVE
RPGAQSSNTVVALDEALFLKGYRRLREGVNPELEVGRFLTEVARFPHCVPVAGSVEYVAP
DGTTMTLALVQSYVANQGDGWEYTLGYLERFLEDTRVAQSAGPAANVHGGYLALAATLGQ
RTAQLHQALARRTGDAAFDPEPVTAQDVAAFRQRARAEAEDTLALLERRLGELPPAAQTD
AQAVLARRALIMERLAAGGTETPTGTRTRFHGDYHLGQVLVTGNDFVIIDFEGEPGRPFE
ERRAKSSPLRDVAGMLRSFNYARWAALKHMTQSTEEMVRLDEAARHWEHQVRDAFLAAYA
AEGLAADPALISLFELEKALYELRYELGNRVDWAQVPLQGILALIGAAAAPTPTPSLPDT
PA
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccccctgctgcgccaacccctaccggccgcggatccgtccgccgggccgctg
cccgaaccgggccccgtggtgatgcccgaaaccccggagatcgacacgcagggcgacccg
cagtggtaccgcgatgccgtcatctaccagttgaacgtgaaagcgttcttcgacagcaac
aacgacggctacggcgacttcaagggcgtgaccgcgaagctggactacgtgaaggacctg
ggcgtcaacacgatctggctgatgcccttctacccctcgccgctgcgcgacgacggctac
gacatcgccgactacgaggacgtgcacccgcagtacggcaccctcgcggacttcaaggag
atgctggacgccgcgcacgagcgcggcctgcgcgtgatcaccgagctggtcatcaaccac
acctcgtccgaccacccgtggttccagcgcgcgcggcgggccccgcccggctcgcccgag
cgggacttctacgtctggagcgacacggaccagatctaccagggcacgcgcatcatcttc
acggacaccgagacctccaactgggcctgggaccccgtggccaagcagtactactggcac
cgcttcttcagccaccagccggacctgaacttcgacaacccgctggtgctggaggccgtg
ttcaagaccatgcgcttctggctggacatgggcgtggacggcttccggctcgacgccatt
ccctacctggtggagcgcgacggcaccagcaacgagaacctgcccgagacgcacgccgtc
atcaagaagctgcgcgcggcgatcgatgcggaatacgggaaccgcttcctgctcgccgag
gccaacatgtggccggaggacgtgcgcgagtatttcggcaacggcgacgaatgccacatg
gcctaccacttcccgctgatgccgcgcatgtacatggcgatcgcccaggaagaccggcat
cccatcgtcgagatcctgcagcagacgcccgacatccccgaaggctgccagtgggccatc
ttcctgcgcaaccacgacgagctcacgctggagatggtgaccagcaaggagcgcgactac
atgtacagcatgtacgcggccgacatgcgcgcgcgcatcaacctgggcatccgccgccgg
ctcgcgccgctgatggagaacgacctggaccgggtcaagctcatgaacggcatgctgctg
tccatgccgggctcgcccatcatctactacggcgacgagatcggcatgggcgacaacgtc
ttcgtgggcgaccgcaatggcgtgcgcacgcccatgcagtggtcgcccgaccgcaacggc
ggcttctcgcgctccgatccgcagcggctctacctgcagcccatcatggacgcggtgtac
ggctacgaggccctgaacgtggaggcccagtcgggcgaccacagttccctgctgcactgg
acgcgccgcatgctggccgtgcgcaagaccagccgcgccttcggccgcgggcgccgcacc
ttcctcaagcccggcaaccgcaagatcctggcgtacgtgagcgaacacgaggacgacgtc
atcctcacggtgttcaacctctcgcgcgccgcccagccggtggaactggacctgtcggcc
taccggggccgcacaccgatcgagatgctcgggcgggtcactttcccgcccatcggcgac
ctgccctacctgctcaccctgcactcctacggtttctactggttccgcctctccaacgag
gccccggtgccctcctggcaccaggagggcctggacctgcaggagcgccccgtgctcgtg
ctgttcgacggctggaccagcttcttccgcgagcgcgtcatgccctggcgcatcggcatg
gccgagcgcatgcgcacgcagttcgaggacgacaccctgccgcggttcatcgaactgcag
cgctggtatgcggacaagggcgcggccatcgccggcgcacgcatcctggaccacacggtg
tggaaggctggcgagggctgcgagtggatgctgccgctgctgggcgtggagccggcagca
aagccgggccagccgcagggcaccgccgcgacctacttcgtgcccctggccctggcctgg
gaggaaggcagcgaggagcgcatgcgccgcatctcgccggccggcgtggcgcgcgtgcgc
cagcaggcccaggtgggcgtgatgggtgatgccttccatgacgagtccttctgccgcgcc
gtggtgcgcgccatgggcgagggaacggaactcgccaccgaccagggcgggcgagtgcgg
ttccggcgcacctcggccttcgacgcgctggccgcggacctggacgcgctgcccgtggaa
cgccccggggcccagagcagcaacaccgtggtcgccctggacgaggccctgttcctcaag
ggctaccgccgcctgcgcgagggcgtgaaccccgagctggaggtcggccgcttcctcacg
gaggtcgcccgcttcccgcactgcgtgccggtggcggggtcggtggaatacgtggcgccc
gacggcaccaccatgacgctcgcgctggtgcagtcctacgtggccaaccagggcgacgga
tgggagtacaccctcgggtacctggaacggttcctggaagacacgcgcgtggcgcagtcg
gccggccccgccgcgaacgtgcatggcggctacctggccctggctgcgaccctcggccaa
cgcacggcgcagttgcaccaggcactggcccggcgcaccggcgatgccgccttcgacccc
gaacccgtcaccgcgcaggacgtggccgccttccgccagcgcgcgcgcgccgaggccgaa
gacacgctcgccctgctggagcggcgcctgggcgagctcccccccgcggcgcagacggac
gcgcaggcggtgctggcgcggcgtgccctcatcatggagcgcctcgcggccggcggcacg
gaaacgcccaccggcaccaggacccgcttccacggcgactaccacctgggccaggtgctg
gtgacgggcaacgacttcgtcatcatcgatttcgagggcgagcccggccggccgttcgag
gagcgccgcgccaagagttcgccgctgcgcgacgtggcaggcatgttgcgctccttcaac
tacgcgcgctgggccgccctcaagcacatgacccagtccaccgaggagatggtgcgcctg
gacgaggccgcgcggcactgggagcaccaggtccgcgacgccttcctggccgcctacgcg
gcggaaggcctggcggccgaccctgccctgatctccctgttcgagctggaaaaagcgctc
tacgaactccgctacgaactgggcaaccgggtggactgggcccaggtaccgctgcagggc
atcctcgcgctgatcggcgcggcagcggcgcccacgcccaccccgagcctgccagacact
cccgcctga

DBGET integrated database retrieval system