KEGG   Acidovorax avenae: Acav_3141Help
Entry
Acav_3141         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX47043
UniProt: F0Q7H0
Position
3575401..3575895
Genome map
AA seq 164 aa AA seqDB search
MTDHGLPPPGNGGAAIDIESAAFPPLVRLLAVAIVGGLAAFALWSIPALRSAQWTFPALA
TFGLAAVLIGWMGWWMVFSRTRFSSEDGGVIVQTWLWDKRVRAADVASFKIVHWPWFRAV
IAPRILLRRKGGGITWVHAADAGVLVAFGESVVRVGAGAVPQSR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccatggactgcccccgcccggcaacggcggggccgccatcgacatcgaaagc
gccgccttcccgcccctggtgcggctgctcgccgtggccatcgtgggcgggctggcggcc
ttcgcgctctggtccatccccgcgctgcgcagcgcgcaatggacctttccggccctggcg
accttcggcctcgcggccgtgctgatcggctggatgggctggtggatggtgttcagccgc
acgcgcttttccagcgaagacggcggcgtgatcgtgcagacctggctctgggacaagcgg
gtgcgggcggccgacgtggcgagcttcaagatcgtgcactggccatggttccgtgccgtg
atcgcgccgcgcatcctgctgcgccgcaagggcggagggatcacgtgggtgcatgcggcg
gatgcgggggtgctggtggcgttcggggagagtgtggtgagggtgggggctggggctgta
ccccaatcacgctga

DBGET integrated database retrieval system