KEGG   Acidovorax avenae: Acav_3144Help
Entry
Acav_3144         CDS       T01445                                 

Definition
(GenBank) deoxyxylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
aaa  Acidovorax avenae
Pathway
aaa00730  Thiamine metabolism
aaa00900  Terpenoid backbone biosynthesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Acav_3144
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acav_3144
Enzymes [BR:aaa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     Acav_3144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ADX47046
UniProt: F0Q7H3
Position
complement(3578008..3579876)
Genome map
AA seq 622 aa AA seqDB search
MSTNSFPLLQTVNDPADLRRMSRAQLKELAAELRAFVLDSVSKTGGHLSSNLGTVELTVA
LHAVFDTPRDRLVWDVGHQTYPHKILTGRRDRMPTLRQLGGLSGFPQRTESEYDTFGTAH
SSTSISAALGMALAARQRGEDRRAVAIIGDGAMTAGMAFEALNNAGVADADLLVILNDND
MSISPPVGALNRYLAQLMSGHFYAAAKNVGKTVLKPVPPLLELAKRFEQQAKGMVVPATL
FEKFGFNYIGPIDGHDLDSLIPTLENIKGLKGPQFLHVVTKKGQGYKLAEADPVAYHGPG
KFDPSVGITPPATPPKQTFTQVFGQWLCDMAAQDERLVGITPAMREGSGMVEFEKSFPGR
YYDVGIAEQHAVTFAAGMACEGVKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFALDRAG
LVGADGATHAGAYDIPFVRCIPNMSIACPADERECRQLLSTAYEQDHPVAVRYPRGSGAG
VAPLPGLEGLPFGKGEVRRAGQRIAILAFGTLLYPALQAAETLDATVANMRWAKPLDTAL
LLEIAAGHDALVTVEEGAVLGGAGSAVCEALNAAGIQKPVLQLGLPDVFIEHGDPARLLA
LQGLDAEGIVRSITARFGPAAG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgaattccttccctctcctgcagaccgtgaacgacccggccgacctgcgccgc
atgtcgcgcgcccagctgaaagagctggccgcggagctgcgcgcattcgtgctggacagc
gtgtccaagacgggggggcatctcagttccaacctcgggacggtggaactcacggtggcg
ctgcacgccgtgttcgataccccgcgcgaccggctggtgtgggacgtgggccaccagacc
tatccgcacaagatcctcaccggccggcgcgaccgcatgcccactctgcgccagctgggc
gggctctcgggctttccccagcgcacggaaagcgagtacgacacgttcggcaccgcgcat
tcgagcaccagcatctccgcggccctgggcatggcgctggccgcacgccagcggggcgag
gaccgccgcgccgtggccatcatcggcgacggcgccatgaccgccggcatggctttcgag
gcgctgaacaacgcgggggtggccgatgccgacctgctggtcatcctcaacgacaacgac
atgagcatcagcccgcccgtgggcgcgctcaaccgctacctggcgcagctcatgagcggg
cacttctacgccgccgcgaagaatgtcggcaagacggtgctcaaacccgtgccgccgctg
ctcgagctcgccaagcgcttcgagcagcaggccaagggcatggtggtgcccgccacgctg
ttcgagaagttcggcttcaactacatcggcccgatcgacgggcacgacctggattcgctc
attcccacgctggagaacatcaagggcctgaaagggccgcagttcctgcacgtggtcacg
aagaaggggcagggctacaagctggccgaggccgacccggttgcctaccacggcccgggc
aagttcgatcccagcgtcggcatcaccccgcccgccacgccaccgaagcagaccttcacg
caggtgttcgggcagtggctctgcgacatggccgcgcaggacgagcggctcgtgggcatc
acaccggccatgcgcgagggctcgggcatggtggagttcgagaagagttttccgggccgc
tactacgacgtgggcatcgcagagcagcatgccgtgaccttcgccgcgggcatggcctgc
gagggcgtgaagcccgtggtggcgatctactccaccttcctgcagcgcgcctacgaccag
ctcatccacgacgtggcactgcagaacctgccggtggtgttcgcactggaccgcgcgggc
ctcgtcggcgccgacggcgccacgcatgcgggcgcctacgacatccccttcgtgcgctgc
attcccaacatgagcatcgcctgcccggcggacgagcgcgagtgccggcaattgctgtcc
accgcctacgaacaggaccaccccgtggccgtgcgctatccgcgcggcagcggcgcgggc
gttgctcccctgccgggactggaggggttgcccttcggcaaaggcgaagtgcgccgcgcg
ggacaacgcatcgcgatcctggcattcggcacgctgctgtaccccgcgctgcaggccgcc
gaaacgctggacgccacggtggccaacatgcgctgggccaagccgctggacaccgcgctg
ctgctggagatcgcggccgggcacgacgccctggtgacggtggaagagggcgccgtgctg
ggcggtgccggcagcgccgtgtgcgaggcgctgaacgccgccggcatccagaagcccgtg
ctgcagctcggcctgccggacgtgttcatcgagcacggcgacccggcccgcctgctcgcg
ctgcagggcctcgatgccgagggcatcgtgcggtccatcacggcacgcttcggtcccgcc
gcgggctga

DBGET integrated database retrieval system