KEGG   Acidovorax avenae: Acav_3146Help
Entry
Acav_3146         CDS       T01445                                 

Definition
(GenBank) exodeoxyribonuclease VII, small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
aaa  Acidovorax avenae
Pathway
aaa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Acav_3146
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aaa03400]
    Acav_3146
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Acav_3146
DNA repair and recombination proteins [BR:aaa03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     Acav_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S
Motif
Other DBs
NCBI-ProteinID: ADX47048
UniProt: F0Q7H5
Position
complement(3580873..3581121)
Genome map
AA seq 82 aa AA seqDB search
MPKASPPASAPPSAEPASYEAALEELEQLVGRIESGQLPLEQMLAGYQRGAELLAFCRGR
LEAVQDQIKVLENGTLQPWTQD
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggcctctcctcccgcttccgcccccccgtccgccgagcccgcgagctacgaa
gctgcgctcgaggagctggaacagctggtgggccgcatcgagtcgggccagctgccgctc
gagcagatgctggccggctaccagcgcggcgcggagctgctggcgttctgccgtggccgc
ctggaggccgtgcaggaccagatcaaggtgctggagaacggcacgctgcaaccgtggacg
caagactga

DBGET integrated database retrieval system