KEGG   Acidovorax avenae: Acav_3147Help
Entry
Acav_3147         CDS       T01445                                 

Definition
(GenBank) Rieske (2Fe-2S) iron-sulfur domain protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_A Rieske
Motif
Other DBs
NCBI-ProteinID: ADX47049
UniProt: F0Q7H6
Position
3581385..3582524
Genome map
AA seq 379 aa AA seqDB search
MSDLSLQLQQAASQLPVSSYFDDALFRRELDTIFQRGPRYVGHQLSVPEPGDYYALPQEG
QGRALVRNAQGGIELVSNVCRHRQAVMLQGRGNLRTNGKGHAAGNIVCPLHRWTYSPQGE
LLGAPHFSHDPCLNLNNYALREWNGLLFEDNGRDIAADLAGMGPLAELSFDGYVLDKVEL
HECNYNWKTFIEVYLEDYHVGPFHPGLGNFVTCDDLRWEFQKHYSVQTVGVASTFGKPGS
DVYRKWHEVLLNYREGRMPERGAIWLTYYPHIMVEWYPHVLTVSTLHPISPTRTLNMVEF
YYPEEIAAFEREFVEAQQAAYMETCIEDDEIGERMDAGRKALLARGDNEVGPYQSPMEDG
MQHFHEWYRDAMGAAVPRG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttaagtcttcaactgcagcaggccgcaagccaactaccagtttcaagctat
ttcgatgatgcgctgttccggcgcgagctggacaccatctttcagcgcgggccccgctat
gtggggcaccagctgagcgtgcccgaaccgggcgattattacgcgctgccgcaggaagga
cagggccgtgccctggtgcgcaacgcgcagggcggcatcgaactggtctccaacgtgtgc
cgccaccgccaggcggtgatgctgcagggccggggcaacctgcgcacgaacggcaagggc
cacgccgcgggcaacatcgtctgcccgctgcaccgctggacgtactcgccccagggcgag
ctgctgggcgcgccgcacttctcgcacgacccctgcctgaacctgaacaactacgcgctg
cgcgagtggaacggcctcctcttcgaggacaacggccgcgacatcgccgccgacctcgcc
ggcatgggcccgctcgcggagctctcgttcgacggctatgtgctcgacaaggtcgagctg
cacgagtgcaactacaactggaagaccttcatcgaggtctacctcgaggactaccacgtg
ggcccgttccacccggggctgggcaacttcgtcacctgcgacgacctgcgctgggagttc
cagaagcactattccgtgcagaccgtgggcgtggcctccaccttcggcaagcccggctcg
gatgtgtaccgcaagtggcacgaggtgctgctgaactaccgcgagggccgcatgcccgag
cgcggcgcgatctggctcacctactacccccacatcatggtggagtggtatccgcacgtg
ctcaccgtgtccacgctgcaccccatcagcccgacgcgcacgctcaacatggtcgagttc
tactaccccgaggagatcgccgccttcgagcgtgaattcgtcgaggcccagcaggccgcc
tacatggagacctgcatcgaggacgacgagatcggcgagcgcatggacgcgggccgcaag
gccctgctggcgcgcggcgacaacgaggtcggcccctaccagagcccgatggaagacggc
atgcagcacttccacgagtggtaccgcgacgccatgggcgccgccgtgccgcgcggctga

DBGET integrated database retrieval system