KEGG   Acidovorax avenae: Acav_3148Help
Entry
Acav_3148         CDS       T01445                                 

Definition
(GenBank) putative transmembrane protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: ADX47050
UniProt: F0Q7H7
Position
3582676..3583593
Genome map
AA seq 305 aa AA seqDB search
MQALWMVLAAFLFASMGVCVKLASAHFNAAELVCYRGIIGMAILWALARRQGVGLGTRYP
GMHAWRSLIGVASLGAWFYAIAHLPLATAMTLNYMSSVWIAAFIVGGALLAWRPSGGAGG
TRPPLQAPLVLTVMAGFAGVVMMLRPSIGANEMFAGLIGLLSGLSAAFAYMQVMALSRIG
EPETRTVFYFAVGSAVAGGAAMLLTGASAWPGWPGLWLLPIGILAAAGQLCMTRAYARAG
SQRGTLVVANLQYSGIVFAGVYSVVLFGDDIPPIGWAGMALIIVSGIVATVLRARAAPGA
PAEEH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctctggatggtcctcgccgcattcctcttcgcgagcatgggggtctgcgtg
aagctggcatcggcccatttcaacgcggccgagctggtgtgctaccggggcatcatcggc
atggccatcctctgggcgctggcgcggcgccagggcgtggggctgggcacgcgctacccg
ggcatgcatgcctggcgcagcctgatcggcgtggcctccctgggcgcctggttctatgcc
atcgcgcacctgccgctcgccaccgccatgacgctcaactacatgagcagcgtgtggatc
gccgccttcatcgtgggcggtgccctgctggcgtggcggccttcgggcggtgccggcggc
acgcgcccgcccctgcaggcgccgctggtgctgacggtgatggccggcttcgccggcgtg
gtcatgatgctgcgccccagtattggtgccaacgagatgttcgccggcctgatcgggctg
ctctcgggcctgtccgccgccttcgcctacatgcaggtgatggcgctgtcgcgcatcggc
gagccggagacgcgcacggtgttctatttcgcggtcggctcggccgtggcgggcggcgcg
gccatgctgctcacgggcgcctcggcgtggccgggctggcccggcctgtggctgctgccc
atcggcatcctcgccgccgcgggccagctctgcatgacgcgcgcctatgcgcgggcgggc
tcgcagcgcggcaccctggtggttgccaacctgcagtattccgggatcgtgttcgcgggg
gtgtacagcgtggtgctgttcggcgacgacattccccccatcggctgggccggcatggcg
ctgatcatcgtgagcgggatcgtcgccaccgtattgcgcgcgcgtgcggcacccggcgcg
ccggcggaagagcactga

DBGET integrated database retrieval system