KEGG   Acidovorax avenae: Acav_3151Help
Entry
Acav_3151         CDS       T01445                                 

Definition
(GenBank) Phosphonate-transporting ATPase
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
aaa  Acidovorax avenae
Pathway
aaa02010  ABC transporters
Module
aaa_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Acav_3151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaa02000]
    Acav_3151
Transporters [BR:aaa02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    Acav_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran NIL AAA_21 SMC_N AAA_22 ABC_ATPase AAA_29 AAA_16 SbcCD_C RsgA_GTPase MMR_HSR1 TniB AAA_23
Motif
Other DBs
NCBI-ProteinID: ADX47053
UniProt: F0Q7I0
Position
3585664..3586929
Genome map
AA seq 421 aa AA seqDB search
MAFASVLRCAPAFPGPGGPRATVLLRTGVAASAAVPSFPGADAAPAADGTAAPRGTVALR
GVGKIYASPAGDVAALQEIDLDIPAGSIFGIIGRSGAGKSSLLRTINRLETPSHGQVLID
GVDIGTLDDDGLVALRRRIGMVFQHFNLLSAKTVFDNIALPLRVAGARPAEVTRRVNELL
ELVGLQDKHRSHPGRLSGGQKQRVGIARALATDPEILLCDEATSALDPETTHAILQLLKD
INRRLGITVILITHEMRVIREIADQVVVLERGRIAEQGPVWQVFGAPRHDATRALLAPLR
QGLPPDLRARLQAHPPQGGPFAAIVQLGYSGEGGLEPDLARIAAALRPGARLVHGGVDRI
QGHAQGELVLAVDGGAALADLAPLTTGPDAIAHSVQVIGYLPHGPSQPPAAHPSTHPPAH
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgcctccgtgctgcgctgcgctccagcgttcccaggtcctggcgggcctcgg
gccaccgtcctgctgcgcaccggcgtcgcggcatcggccgccgtgccctcctttcccggc
gcggacgcagccccggcggccgacggcacggctgcgccgcggggcaccgtcgccctgcgc
ggcgtcggcaagatctacgcgtctcccgctggcgacgtggccgcgctgcaggagatcgac
ctggacatcccggccggcagcatcttcggcatcatcggccgcagcggcgcgggcaagtcc
agcctgctgcgcaccatcaaccggctggagacgccgtcgcacgggcaggtgctcatcgac
ggcgtggacatcggcacgctggacgacgacggcctggtcgcgctgcgccgccgcatcggc
atggtcttccagcatttcaacctgctgtccgccaagacggtgttcgacaacatcgccctg
ccgctgcgcgtggcgggcgcccgccctgcggaggtcacgcggcgggtgaacgaactcctg
gaactcgtgggcctgcaggacaagcaccgcagccacccgggccggctgtccggcggacag
aagcagcgcgtgggcatcgcgcgcgccctggccaccgacccggagatcctgctgtgcgac
gaggccacttcggccctggacccggaaaccacgcacgccatcctgcaactgctgaaggac
atcaaccggcgcctgggcatcaccgtcatcctgatcacacacgagatgcgcgtgattcgc
gagatcgccgaccaggtggtggtgctcgagcgaggacgcatcgccgaacagggccccgtc
tggcaggtgttcggcgcgccgcgccacgatgccacgcgggcgctgctggccccgctgcgc
cagggcctgcctccggacctgcgcgcacggctgcaggcgcatccaccgcagggcggcccg
ttcgcggccatcgtgcagctcggctacagcggcgaaggcggcctcgagcccgatctcgcg
cgcatcgccgccgccctgcgccccggcgcacggctggtgcacggcggcgtggaccgcatc
caggggcatgcgcagggcgagctggtgctggccgtggacggcggcgccgcactggccgac
ctcgccccgctcaccaccggccccgacgcgatcgcccactccgtccaggtgatcggctac
ctgccccacggcccgtcgcagcctccggcagcacatccatccacgcatccacccgcccac
ccatga

DBGET integrated database retrieval system