KEGG   Acidovorax avenae: Acav_3156Help
Entry
Acav_3156         CDS       T01445                                 

Definition
(GenBank) flagellar transcriptional activator
  KO
K02403  flagellar transcriptional activator FlhD
Organism
aaa  Acidovorax avenae
Pathway
aaa02020  Two-component system
aaa02024  Quorum sensing
aaa02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acav_3156
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Acav_3156
  09142 Cell motility
   02040 Flagellar assembly
    Acav_3156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:aaa02035]
    Acav_3156
Bacterial motility proteins [BR:aaa02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    Acav_3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlhD DUF2857
Motif
Other DBs
NCBI-ProteinID: ADX47058
UniProt: F0Q7I5
Position
3591988..3592317
Genome map
AA seq 109 aa AA seqDB search
MTSEQLLAEIREANLTYLMLAQTLIRQDKAEAVFRLGINEDAADILASLSAAQVLKLASR
NTLLCSFRVDDNLVWSLLTNHNTPKKVGNEATNTLHANILMASRVSEVL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggaacaacttctcgctgaaatccgcgaagccaacctcacctacctgatgctg
gcccagacgctgatccgccaggacaaggccgaagccgtgttccgcctgggcatcaacgaa
gacgccgcggacatcctggcctccctctcggcggcccaggtgctcaagctggcctcccgc
aacaccctgctgtgcagcttccgcgtggacgacaacctcgtctggagcctgctcaccaac
cacaacacgcccaagaaggtcggcaacgaagccaccaacacgctgcacgccaacatcctc
atggccagccgcgtgtcggaagtgctctga

DBGET integrated database retrieval system