KEGG   Acidovorax avenae: Acav_3158Help
Entry
Acav_3158         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgO
Motif
Other DBs
NCBI-ProteinID: ADX47060
UniProt: F0Q7I7
Position
complement(3593062..3593694)
Genome map
AA seq 210 aa AA seqDB search
MKNEDSIQRQIPRRAWLRMGLRGGLGLAAVACLPGCARYYYGAAAAPPSGGGVMGALGMG
GSPAESLLETNQAAADALLRQVPQLDPRQPVLVATLVHIDRLDEASRLGRLFSEQIAGRL
VQRGVRVTELKLRQNLVMVPGQGELLLSREVRDVSRAQAAQAVVVGTYAATAQSVFVSLK
LVGPEGNAVLAAHDYVVPVDDNVRILLSMR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgaagattccatccagcggcagattccgcggcgcgcctggctgcggatgggc
ctgaggggcggcctgggcctggccgccgttgcctgcctgccgggctgcgcccgctactac
tatggcgccgcggctgcgccgccgtcgggtggcggtgtgatgggcgcgctgggcatgggc
ggctcgccggcggaatcgctgctggagaccaaccaggccgcggccgatgcgctgctgcgg
caggtgccgcagctcgacccgcgccagcccgtgctggtggcgacgctggtgcacatcgac
cggctggacgaggcgtcgcgcctggggcgccttttctccgagcagatcgccgggcggctg
gtgcagcgcggcgtgcgggtgaccgaactgaaattgcggcagaacctcgtgatggtgccc
gggcagggtgagctgctgctgtcgcgcgaggtgcgggacgtgagccgtgcgcaggccgcg
caggccgtggtcgtgggaacctatgccgccacggcgcaatcggtgttcgtgagcctgaag
ctggtggggccggagggcaatgccgtgctcgccgcccacgactacgtggtgccggtggac
gacaacgtgcgcatcctgctgtccatgcgctga

DBGET integrated database retrieval system