KEGG   Acidovorax avenae: Acav_3167Help
Entry
Acav_3167         CDS       T01445                                 

Definition
(GenBank) ABC transporter related protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_22 AAA_16 SbcCD_C NACHT AAA_28 MMR_HSR1 AAA_18 RNA_helicase AAA DUF2894 NTPase_1 AAA_24 AAA_14 ATPase_2 Rad17 AAA_33 AAA_25
Motif
Other DBs
NCBI-ProteinID: ADX47069
UniProt: F0Q7J6
Position
complement(3606263..3607993)
Genome map
AA seq 576 aa AA seqDB search
MATFNADDRPLSSRSASRAASSFSGPTLSSHGAEGAASRLHLRQVQWCPPGSEPLWDEPP
ALSLPPGITGLVGDNGVGKSVLLSIAAGALQPSSGNVLYTGTLRSVGQHPPGATLAALAG
LDRELEALQRLECGQGTAEDLLLADGRWDWPARWRQALEGAGLGHLQGDADANRLSGGER
VRVALAGAFFSQAEVLLLDEPTNHLDGEARRWLQQALEGGRGGPRAVLLASHDRALLECA
DRIAELSPRGLRLYGGGWSAYAAQKAVETQAAHEALRQARVQRDGVLRDLRRQQDAQARR
SARGAAARRVANQSPLVLDRMKDQAEAHAGREDMRRQQARERIEETVREAFARVGPEAAV
VLPLPASTVPAGKPVLRLEGAVPPFGPRAPLDGVWSGPVRIAVTGPNGCGKSTLLRMLAG
HVPPAAGRAGCLVRAVWLDQDAGGLLPPEHSVMEALALAESPLPTAELRTRLAQLGLDAD
RVLLPSGSLSGGERVRAALACALWGGAPAQLLLLDEPSNYLDARAVQVLQEALSSFTGAM
VVVSHDRHFLQALAPQVAWTWEDGRWNLDGALEPVA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcaatgcggacgaccgtccgctttcctcccgcagcgcatcgcgcgctgcc
tcttccttttccggccccaccttgtcctcccatggcgcggagggggccgcctcgagactc
catctgcggcaggtgcagtggtgccctcccggcagcgagccgctgtgggacgagccgccg
gcgttgagcctgccgcccggtatcaccggcctggtgggcgacaacggcgtgggcaagagc
gtgctgctgtcgatcgcggccggcgcgttgcagccgtcttccggcaatgtgctgtacacg
gggacattgcggtccgtgggccagcatccgccgggcgcgaccctggccgcgctggcaggc
ctcgaccgcgaactggaggcattgcagaggctggagtgcggccagggcaccgccgaggac
ctgcttctggcggacggccgctgggactggccggcccgctggcggcaggcgctggagggg
gcggggctcggccacctgcagggcgatgccgatgccaaccgcctcagcggcggggagcgt
gtgcgcgtggcgctggccggagcctttttttcgcaggccgaggtgctgctgctggacgag
ccgaccaaccacctggatggcgaagcacggcgctggctgcagcaggcgctggagggcggg
cgtggcgggccacgtgccgtgcttttggcgagccatgaccgggcgctgctggagtgcgcg
gaccgcatcgcggaactgtcaccgcgcggcctgcggctgtacggcggcggctggagcgcg
tatgccgcacagaaggcggtcgaaacccaggccgcacacgaagccctgcggcaggcgcgg
gtgcagcgcgatggcgtgctgcgggacctgcgccgccagcaggatgcccaggcgcggcgc
agcgcgcgcggggccgcggcacgccgggtggcgaaccagtcgcccctggtgctggaccgc
atgaaggaccaggccgaagcgcacgcggggcgggaggatatgcgccggcagcaggcgcgt
gaacggatcgaggaaaccgtgcgcgaagcattcgccagggtggggccggaggcggccgtg
gtgctgccgctgcctgccagcaccgttccggcaggcaagccggtgctgcggctggagggg
gcggtgccgccgttcgggccacgggcgccgctcgacggggtctggagcgggccggtgcgc
atcgccgtgaccgggcccaatggctgcggcaagagcaccctgctgcgcatgctggccggg
cacgtgccgcccgcggcgggccgcgctggctgcctggtgcgtgcggtctggctggaccag
gatgccgggggcctgttgccgccggagcacagcgtgatggaggcactcgcgctggcggaa
tcgccgctgcccacggcagaactgcgcacgcgcctggcgcaactcggcctggatgcggac
cgggtactgctcccgtccggcagcctcagcgggggtgagcgcgtgcgggcggcgctggcc
tgtgccctgtggggtggcgcgcccgcgcaactgctgctgttggacgagccctccaattac
ctggatgcccgcgcggtgcaggtgctgcaggaggcgctgtcatcgttcaccggggcgatg
gtggtcgtgtcgcatgaccggcacttcctgcaggcactggcgccgcaggtggcctggacc
tgggaggatgggcgctggaacctcgatggtgcgctggagccggtggcttag

DBGET integrated database retrieval system