KEGG   Acidovorax avenae: Acav_3171Help
Entry
Acav_3171         CDS       T01445                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aaa  Acidovorax avenae
Pathway
aaa00040  Pentose and glucuronate interconversions
aaa00052  Galactose metabolism
aaa00500  Starch and sucrose metabolism
aaa00520  Amino sugar and nucleotide sugar metabolism
aaa01100  Metabolic pathways
aaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acav_3171
   00052 Galactose metabolism
    Acav_3171
   00500 Starch and sucrose metabolism
    Acav_3171
   00520 Amino sugar and nucleotide sugar metabolism
    Acav_3171
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acav_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADX47073
UniProt: F0Q7K0
Position
3614039..3614926
Genome map
AA seq 295 aa AA seqDB search
MSDNSAIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVT
GRSKRAIEDHFDTAYELENELEAAGKNELLQLVRSVAPNDMDCAFVRQPRSLGLGHAVLC
AEPLVGREPFAVLLADDLMVGPPGGQPVMAQMAAAFRKQGRSLLAVQEVPQDQVRRYGIV
AGEPAGGPLIRIERIVEKPAPEDAPSRMGVAGRYILTPGVFDEIRNQPQGVGGEIQLTDA
IARLMAREAVYAFRYEGKRYDCGSKEGFLEATVELALQHPQVGAAFREYLKTVEI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaactccgcgatccgcaaagccgtcttccccgtggccggcctgggcacccgc
ttcctgcccgccacgaaggcatcccccaaggagatgctgccggtggtggacaagccgctg
atccagtacgccgtcgaagaggcctatgcggccggcatccgccacatgatcttcgtcacc
ggccgcagcaagcgcgccatcgaggaccacttcgacaccgcctacgagctggagaacgaa
ctggaagccgccggcaagaacgaactgctgcagctcgtgcgctcggtcgcccccaatgac
atggactgcgccttcgtgcgccagccgcgctccctgggcctgggccatgcggtgctttgc
gccgagccgctcgtgggccgcgaacccttcgccgtgctgctcgcagacgacctcatggtc
ggcccccccggcggccagcccgtcatggcccagatggcggccgccttccgcaagcagggc
cgctcgctgctggccgtgcaggaagtgccgcaggaccaggtgcgccgctacggcatcgtg
gccggcgagcccgccggcggcccgctgatccgcatcgagcgcatcgtcgagaagccggcc
cccgaagatgcgccctcgcgcatgggcgtggccggccgctacatcctcacgccgggcgtg
ttcgacgagatccgcaaccagccccagggcgtgggcggcgagatccagctcaccgatgcc
atcgcccgcctcatggcccgcgaagccgtctatgccttccgctacgaaggcaagcgctac
gactgcggcagcaaggaaggcttcctggaagccacggtggaactcgcgctgcaacatccc
caggtgggcgccgccttccgcgaatacctcaagaccgtggaaatctga

DBGET integrated database retrieval system