KEGG   Acidovorax avenae: Acav_3173Help
Entry
Acav_3173         CDS       T01445                                 

Definition
(GenBank) NUDIX hydrolase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX Nudix_N_2 DZR C1_1
Motif
Other DBs
NCBI-ProteinID: ADX47075
UniProt: F0Q7K2
Position
complement(3615334..3615948)
Genome map
AA seq 204 aa AA seqDB search
MHSEPRFCTQCATLLAWVTALEDGGERQRLRCPACGWTHWNNPTPVLAAVVELDGRVLLA
RNAAWEHKAFALITGFMEAGESPQEGIVREVKEETNLDVSALSLIGVYDFQRMNQVIVAY
HAVAHGTVRLSPELVDYRLIAPENLRCWPAGTGQALADWLRGRGIEPTFMEWPGQRSEAP
AAPVQAGSVAGPAAGLAQPQPGPL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgaaccgcgtttctgcacccagtgcgccacgctgctggcctgggtcacggcc
ctggaggacggcggggagcggcagcgcctgcgctgccccgcctgtggctggacgcactgg
aacaatcccacgccggtgctggccgcggtcgtcgaactggacgggcgcgtgctgctggcg
cgcaatgcggcgtgggagcacaaggccttcgcgctgatcaccggcttcatggaggcgggc
gagtcgccgcaggaaggcatcgtgcgcgaggtgaaggaagagacgaacctcgacgtgagc
gcgctgtcgctgatcggggtgtacgacttccagcgcatgaaccaggtcatcgtggcctac
catgcggtggcgcacggcacggtgcggctctcgcccgaactggtggactaccggctgatc
gcgccggagaacctgcggtgctggcccgccggcaccggccaggcgctggccgactggctg
cgcggccgcggcatcgagcccacgttcatggagtggccgggccagcgcagcgaggcaccc
gccgccccggtgcaggcgggctccgttgcaggcccggcagcagggctggcgcagccgcag
cccgggccgctctag

DBGET integrated database retrieval system