KEGG   Acidovorax avenae: Acav_3180Help
Entry
Acav_3180         CDS       T01445                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 Gln-synt_N_2 HTH_28
Motif
Other DBs
NCBI-ProteinID: ADX47082
UniProt: F0Q884
Position
complement(3620968..3621867)
Genome map
AA seq 299 aa AA seqDB search
MRRILPSTQALACFEAAARHESYTRAAQELFLTQSAVSRQIMALEEFLGVALFRRTRHGV
ALTPAGTHYAAQVGRWLEGLERDTLDVMAHQGQGGSIRLAAVPTFATRWLVPRLPQLAAR
HPDIVVHIETQVRPFLFADAGFDAALYAGTPEQVANWPGTQALWLLQEDVAPVCSPALLP
GGRPLAPEALAELPLLQQTTRPLAWRQWFESMGVHAPQHALDGPRYELFSMSAVAAAHGL
GVALVPLMLIEPERARGELVPACDRPPRGGRGYYFVTPAQSPPPVVAAFGAWLQDMAAT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcatcctgccgtccacccaggccctggcctgcttcgaagccgctgcccgccac
gaaagctacacccgtgcggcccaggagctgttcctcacgcaaagcgccgtgtcgcggcag
atcatggcgctggaggaattcctgggcgtggccctgttccgccgcacccgccacggtgtg
gcgctgacgcctgccggcacccactatgccgcccaggtcgggcgctggctcgaaggcctg
gagcgcgacacgctcgacgtgatggcccaccaggggcagggcggctcgatccgcctcgcg
gccgtgccgaccttcgccacccgctggctggtgccccgcctgccgcaactggccgcgcgc
catcccgacatcgtggtgcacatcgagacccaggtgcgccccttccttttcgcggacgcg
ggcttcgatgcggccctctatgccggcacgcccgagcaggtggccaactggcccggtacc
caggcgctgtggctgctgcaggaggacgtggcgcccgtctgcagtccggcgctgttgccg
gggggccggcccctggcgccggaagccctggctgaactgccgctgctgcagcagacgacg
cggcccttggcatggcgccagtggttcgaatccatgggggtgcatgcgccccagcatgcc
ctggacggtccgcgctacgaactcttttccatgtccgccgtggcggctgcccacggcctg
ggcgtggcgctggtgccgctgatgctgatcgagccggagcgtgcacggggcgaactggtg
ccggcctgcgaccgtccgccgcggggagggcggggctactacttcgtcacccccgcgcag
tccccgcccccggtcgtcgcggccttcggcgcgtggttgcaggacatggccgcgacttga

DBGET integrated database retrieval system