KEGG   Acidovorax avenae: Acav_3194Help
Entry
Acav_3194         CDS       T01445                                 

Definition
(GenBank) protein of unknown function UPF0118
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport
Motif
Other DBs
NCBI-ProteinID: ADX47096
UniProt: F0Q898
Position
3634640..3635698
Genome map
AA seq 352 aa AA seqDB search
MEPLPTAELPPAAPTRGVRTASYLLMGGALLLVMWQGLLPGLICACLGFLLTRWLAPRLA
GTLPRGWQAGGRAMHTGQVVAATLVGIAPLVLLALAATHSRTYVVEAPQQYRELLDFLAR
TVLELRLKLPPDIGAHLPEGAAEIQRTIAGYLGAKAGALAMAGRAWLGGLLHAYVGLLIG
TLAAVRATGGQRGPLAVALADRITYLGEAFRQIVAAQFWIATFNTLLTALFLLAILPLWG
LRLPYTPALITLTFLAGLVPIVGNLLCNAVITIVGLSVSPTAAIACLAFLVLIHKAEYVI
NAKVVGQRTHMGVWELLSVMFVAEAVFGPAGLVAAPLFYAYLKKELEAVRLV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcttccgacggccgaactgcctcccgctgcgccgacgcgcggcgtgcgcacg
gccagctacctgctgatgggcggcgccctgctgctcgtgatgtggcagggcctgctgccc
ggcctgatctgcgcctgcctcggcttcctgctcacccgctggctcgcgccgcggctggcc
ggcacgctgccgcgcggctggcaggccggtggccgtgccatgcacacaggccaggtggtg
gctgccacgctggtcggcatcgcgccgctggtgctgctggcgctggcggccacgcattcg
cgcacctacgtggtggaagcaccgcaacagtaccgcgaactgctcgacttcctggcccgg
acggtgctggagctgcggctcaagctgccgccggacatcggcgcacacctgcccgagggc
gcggcggagatccagcgcaccatcgccggctacctgggcgccaaggccggagcgctggcg
atggccggccgtgcatggctcggcgggctgctgcacgcctatgtgggcctgctcatcggc
acgctggccgcagtgcgggcgaccggcgggcagcgcgggccgctggccgtggcgctggcc
gaccgcatcacctacctgggcgaggcgttccgccagatcgtggcggcgcagttctggatc
gccacgttcaacaccctgctcaccgcgctgttcctgctggccatcctgccgctgtggggc
ctgcgcctgccctacacccccgccctcatcacgctgaccttcctcgcgggcctcgtgccc
atcgtgggcaacctgctgtgcaacgcggtcatcaccatcgtgggcctgtcggtttcgccg
accgcggccatcgcctgcctggccttcctggtgctgatccacaaggccgaatacgtcatc
aatgccaaggtggtgggccagcgcacgcacatgggcgtctgggagctgctgtcggtgatg
ttcgtggccgaggcggtgttcggccccgcgggcctggtggcggccccgctcttctacgcc
tacctcaagaaagagctggaagccgtgcggctggtgtga

DBGET integrated database retrieval system