KEGG   Acidovorax avenae: Acav_3195Help
Entry
Acav_3195         CDS       T01445                                 

Definition
(GenBank) isochorismatase hydrolase
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ADX47097
UniProt: F0Q899
Position
3635821..3636420
Genome map
AA seq 199 aa AA seqDB search
MKTCLLVIDVQESFRHRPFFSEAGLHAYLAAQNALIEGCEARGIPIVRILHSDGPEEASN
PFALASGHVRPLAGLAAFTPAAEFTKHRHSALVGTGLDVWLTRQGIGRLIVSGIRTEQCC
ETTARHASDLGWEVDYVGEATLTWDMRHPDGRMLAAADILARTETVLAGRFATLCTAAEA
LSRATAAAATATAHALEAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgtctgttagtgatcgacgtgcaggagtcgttccgccaccgcccttttttc
tcggaagcaggcctgcacgcctacctggcggcacagaacgcgctcatcgagggttgcgaa
gcgcgcggcattcccatcgtgcgcatactgcacagcgacggccccgaagaggcatcgaac
cccttcgcgctcgcatccgggcatgtgcgccccctggccgggctggccgcattcacgccc
gcggcggagttcaccaagcaccgccacagcgcgctggtgggcaccggcctggatgtctgg
ctcacgcgccagggcatcggccggctgatcgtgagcggcatccgcaccgagcagtgctgc
gagaccaccgcgcgccacgccagcgacctgggctgggaagtggactatgtgggcgaggcc
acgctgacctgggacatgcgccatcccgacggccggatgctggcggcagcggacatcctg
gcccgcacggagacggtgcttgcaggccgcttcgccaccctgtgcacggccgccgaggcg
ctgtcccgcgccaccgctgccgcggcaactgcaacggcgcacgccctggaggccgcatga

DBGET integrated database retrieval system