KEGG   Acidovorax avenae: Acav_3206Help
Entry
Acav_3206         CDS       T01445                                 

Definition
(GenBank) penicillin-binding protein 1C
  KO
K05367  penicillin-binding protein 1C [EC:2.4.1.129]
Organism
aaa  Acidovorax avenae
Pathway
aaa00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Acav_3206
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aaa01003]
    Acav_3206
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaa01011]
    Acav_3206
Enzymes [BR:aaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Acav_3206
Glycosyltransferases [BR:aaa01003]
 Polysaccharide
  Bacterial polysaccharide
   Acav_3206
Peptidoglycan biosynthesis and degradation proteins [BR:aaa01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Acav_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly BiPBP_C Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ADX47108
UniProt: F0Q8B0
Position
complement(3646743..3649157)
Genome map
AA seq 804 aa AA seqDB search
MPAFASLRHWARRLKTETRTVYFAARDSQAPWSVCLRSAAQAGAAVPLCLALWAPLSASA
LPAYAEVRADYRSSETLVLSREGEVVQRLRTDATVRRGQWTGLDDISPALREALVLSEDR
RFYEHSGVDWRAVSAAAWGNLWNQRTRGASTLTMQLAGLLDGDWRQGPGGRSVAQKLGQT
VAAQVLERRWRKDQILEAYLNLVPFRGELVGIDALSRTLFGKAPHGLDDREAAVAAALVR
APNARPALVAQRACGVLRAMAGPRADGAGPGADCDALDLFTTAALQRRDYAASEGLAPHF
ARQLLARMPGPAPASVVSSLSAPLQRVAVQSLHQHLRELHGRNVEDGAVVVLDNATGEVL
AWVGSSGLLSHAGEVDGVLAARQPGSTLKPFLYAQAIAQRRITAASLIEDSPAYIPTASG
LYIPQNYDRQFKGWVSVRTALAASLNVPAVRTIAMVNPDAFFRQLLALGLPLRETGDYYG
YSLALGSAEMPLLHLANAYRALANGGRTGPVVFRPAPAAARRMGSQPAPAAAALAPPAVD
PRAAFIVGDILSDGNARARTFGTDSVLATRFWSAVKTGTSKDMRDNWALGWSQRYTVGVW
VGNAGGAPMHDVSGTSGAAPVWAEIMGWLHGRGVRSRAPEPPPGLVRAAVRFGPEPGGTR
LLESARQEWFLAGTQQSLFAVDAGPGTIRRGRGAPDVAAGEGGAQDGLQAPQPRIVSPAP
GTIVALDPDIPPAHQRLQFAAAGSGVPGNLRWRIDGQVQGRGAEWAWLPWPGRHRVELVD
AAGQVVDEIRIEVRGAGVVKGPRP
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttcgcttccctgcgccactgggcgcgccgcctgaagacggaaacacggacc
gtgtatttcgccgcgcgcgactcccaggcgccctggtccgtgtgcctgcgcagcgctgcg
caggcgggcgccgccgtcccgctgtgcctcgcgctctgggcgccgctctccgcaagcgcg
ctgccggcctacgccgaggtgcgtgcggactaccgctcgtccgaaaccctggtgctctcg
cgcgaaggcgaggtggtgcagcggctgcgcaccgatgccaccgtgcggcgtgggcaatgg
acggggctggacgacatatcgcccgcgctgcgggaggcgctggtgctcagcgaggaccgg
cgtttctacgaacacagcggcgtggactggcgtgccgtgtctgccgccgcctggggcaat
ctgtggaaccagcgcacgcgcggcgcgtccaccctgaccatgcaactcgccggcctgctg
gacggcgactggcggcaggggcccggcggccggtcggtggcccagaagctcggtcagacc
gtggccgcgcaggtgctggaacggcgctggcgcaaggaccagatactggaggcctacctg
aacctcgtgccgttccgcggcgaactggtgggcatcgatgcactgtcccgcaccctgttc
ggcaaggcgccgcacgggctggacgaccgcgaagcggcggtcgccgcggcgctggtgcgg
gccccgaacgcccggcccgccctcgttgcgcagcgtgcctgcggcgtgctgcgcgccatg
gccggtccgcgcgcggacggtgccggcccgggagccgattgcgatgcgctcgacctgttc
accacggccgcgctgcagcgccgggattacgcggccagcgaaggcctggcgccgcatttc
gcgcgccagctgctcgcccgcatgccggggccggctccggcgtccgtggtgtccagcctc
agcgcgccgctgcagcgcgtggccgtgcagtcgctgcaccagcacctgcgcgaactgcac
ggccgcaacgtggaagacggcgccgtggtcgtgctcgacaacgccaccggcgaagtgctg
gcgtgggtgggttcatccggcctgctgagccatgcgggcgaagtggacggggtgctggcc
gcgcgccagccgggctccacgctcaagcccttcctctacgcccaggcgatcgcgcagcgc
cgcatcaccgccgcatcgctgatcgaggattctcccgcctacatccccaccgcctcgggg
ctctacatcccgcagaactacgaccggcagttcaagggctgggtgtccgtgcgcaccgcg
ctggccgcctcgctcaacgtgccggcggtgcggaccatcgccatggtcaacccggatgcg
ttcttccggcagttgctggcgctgggcctgccgctgcgggaaacgggcgactactatggc
tacagcctcgcgctgggcagcgccgagatgccgctgctccacctggccaatgcctaccgc
gcgcttgccaatggcgggcggaccggtcccgtcgtgttccgtcctgcgcctgcagccgcc
aggcgcatgggctcccaaccggccccggccgctgcggcgctggcaccgcccgcggtcgat
ccgcgcgcggccttcatcgtgggcgacatcctctcggacggcaatgcgcgcgcgcgcact
ttcggcaccgacagtgtgctggccacgcggttctggagcgcggtgaagaccggcaccagc
aaggacatgcgcgacaactgggcgctgggctggtcgcagcgctacacggtgggtgtctgg
gtgggcaatgccggcggcgcgcccatgcacgacgtgagcggcaccagcggcgcggcgccc
gtgtgggccgagatcatgggctggctgcacgggcggggcgtgcgcagccgtgcgcccgag
ccaccgcccgggctggtccgcgccgccgtgcgcttcggccccgagccgggcggcacgcgc
ctgctggaaagcgcgcgccaggaatggttccttgccggcacgcagcaatcgctcttcgcc
gtggatgcaggccccggcaccatccggcggggccgcggggcgccggatgtggcggccggc
gagggcggtgcacaggacggcctgcaggccccgcagccgcgcatcgtgtcgcccgccccg
ggcacgatcgtggcgctggaccccgacatcccgcccgcccatcagcgcctgcagttcgcg
gcggcgggcagtggcgtgccgggcaatctgcgctggcgcatagacggccaggtgcagggc
cggggtgcggaatgggcctggctgccctggcccggacgccaccgggtggaactggtggat
gcggcaggccaggtggtggacgagatccgcatcgaggtgcggggggcgggcgtggtgaaa
gggccccgcccctga

DBGET integrated database retrieval system