KEGG   Acidovorax avenae: Acav_3208Help
Entry
Acav_3208         CDS       T01445                                 

Definition
(GenBank) protein of unknown function DUF1486
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 SnoaL
Motif
Other DBs
NCBI-ProteinID: ADX47110
UniProt: F0Q8B2
Position
complement(3651224..3651718)
Genome map
AA seq 164 aa AA seqDB search
MTVKLLLSRAVLACAAAVCLSAHAQVPVAEEPNHDKLLWSHNPILAHNKRLVYDFWREVF
ESGQVELADRYMREDYIQHNPLVATGREPFKQFLAQVTPRSPIQPRVRAPLVRILAEGDM
VTMVFARRLPDPQNAGQTYTTTWFDMFRIQDGQIAEHWDAATKN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaaactgctgctctcccgcgccgtgctggcctgcgcggccgccgtatgcctt
tccgcccacgcccaggtgcccgtggcggaagaaccgaaccacgacaagctgctgtggtcc
cacaacccgatcctcgcgcacaacaagcggctggtgtacgacttctggcgcgaagtgttc
gagtccggccaggtggaactggccgaccgctacatgagggaggactacatccagcacaac
ccgctggtggccacgggccgcgagcccttcaagcaattcctggcgcaggtcacgccgcgc
tcgcccatccagccccgggtgagggccccgctggtgcgcatcctcgccgagggtgacatg
gtcaccatggtgttcgcccgccgcctgccggatccgcagaacgcggggcagacctacacg
accacgtggttcgacatgttccgcatccaggacgggcagatcgccgaacactgggatgcc
gccacgaagaactga

DBGET integrated database retrieval system