KEGG   Acidovorax avenae: Acav_3210Help
Entry
Acav_3210         CDS       T01445                                 

Definition
(GenBank) alpha-2-macroglobulin domain protein 2
  KO
K06894  uncharacterized protein
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Acav_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bMG3 bMG10 MG2 A2M_BRD A2M Big_5 CarboxypepD_reg Big_1 FixG_C SpaA fn3_5
Motif
Other DBs
NCBI-ProteinID: ADX47112
UniProt: F0Q8B4
Position
complement(3652158..3658190)
Genome map
AA seq 2010 aa AA seqDB search
MTTTTHFVRAALAAFLGLASAGAAQALSVSSFSPQGEVARVRQVVVKFDAAAVNFGDPKA
PAPFSVDCGGDASRGTGRWTGEREWVYDFAADLPPGTRCTATARSGFKSASGSALSGTVR
YQFNTGGPFVQSVRPGTYQPIDEEQFFLLQLSGPATLESVKANVWCVAEDVGERIPVRLI
EGTERAALLTSLGLESAAKQAPLRYASLACNRRLTSGSKVQLVYGQGVATPSGVPNTVER
RYGYTVREPFSAEFGCERENAQAACLPIRPMRLSFNAPVPRKLAEAIRLKSDKETLKPRL
DGEGDGDTVVNSVQFMPPFAPQTAMRLELPKDFKDASGRPLRNADSFPLALSTGPMPPLA
KFAASPFGVVERFAEGDKGPALLPVTLRNVEADLRVQGLAAGAAPGASAPAAAPAPAGKV
STFQPTADADIIAWYRRVRRYDDYLVTRREASRDVRGPLPQVLQDEGKDTVQSRMVSLLG
GQPRARVLDLPRPASGDPRPFEVVGIPLPPGFHVVEIASPMLGRSLLDERHGAGRTMYVR
TSALVTNLGVHFKLGRENAAAWVTTLDKGQVVPGAVVRVSGCDGRELATATTDAQGIARF
EGLSPQPPSCPGRDGLEGMNAYFVSARAQGADGVQDMAFTWSDWQRGIEPWRFNVPTSSQ
PEPDQIAHTIFDRTLLRAGETVSMKHILRTQNRQGFGLPDAQPHTLAITHVGSGQQFTQP
LQWRRTPTGGLSAESTFALPPAAKLGVYSVELRGDDDSRGRSFTSGEFRVEEFRLPVLEG
RIAPADKKPLVRPRSVPTDVQVNYVSGGGAANLPVRVSALVRGKPLQFPDFDAFSFEPPR
RKGAQPQGGNSGDDEEPASADDARVIADKLAVTLDRNGAGKVAIDNIPNSRRAQDLVLEA
TYSDPNGEVQTLRSTQTVWPAAVVAGIKTEGWVSAAQKIRFQALALGLDGKVQEGVPMQV
QAVARITTTSRKRMVGGFYSYDNKTETKDLGTVCTGKSDSRGLVLCEAKLDEAGEVELVA
TARDKDGNQSEAAASVWVTRQGELWFGGEDHDRIDLLPEKKSYQPGETARLQVRMPFRQA
TALVSVEREGIIDMHVVQLNGQDPTVQLKIEEGWGPNVYVSVLALRGRLREVPWYSFFTW
GFKAPREWWTAFWYEGKEYVAPTAMVDLSKPAYRLGLAEIKVGAKAHRIEVKVTADKESY
PVRGKAQVTIAATLPDGKPAANAEVAVAAVDQALLELMPNTSWNLLDAMLQRRAWGVETS
TAQMEIIGRRHYGKKAVPAGGGGGRAQTRELLDTLLLWQPAVRLDANGRAQVTVPLNDAL
TTFKIVAVADAGTGQFGTGSTSIRATQDLQIISGLPPLVREDDQFRAQFTLRNTTKAAMK
VEVAPRATLLALDKQTVDIPAGESREVAWNVTAPAQLARTRAEAILWEIEARDTTPGAAG
ARDALKATQRLVPAVPLTVQQATLVQVDGSFGIDVKPPADAIPGRGGLKMSVQPKLAEGL
PGVRDWFANYPFLCLEQKTSKAVGLRDGKMWQTVVGQLPTYLDGDGLASYFPPQAGSGNR
GSDTLTAYLLAATHEASSIDPAFALSPEVRAPMERGLIAFVEGRIQRDFWSPRKDLDMRK
LAAIEALSRYGKATGRMLSSITVAPNQWPTHSVIDWLNILRRVTDAPQREQRMAEATQIL
KSRLSYQGTKLIFSSEQDDYWWWLMQNGDVNTARLMLAVMDDPAWKDDMGRLANGFIARQ
QGGAWHTTTANLWGGLALEKFSAKFEATPVTGFTRAAMGGNTASVDWSKVGRVSTADATG
AVHQTTWFGAPASPGNLTNNGMFLPWSASGGKETLNVTQQGTGKPWLTLQSVAAVQLKEP
FSAGYTVKKTITPVEQAVAGRYTRGDVLRIKLEVTSTADMTWVVLTDPVPGGATILGNGL
GRDSEIATQGEKRGSGGSGGSGWLAYEERSFEAWRGYYEYVSKGSLTAEYTVRLNNVGEF
ALPPTRVEAMYAPEMFGETPNPRMKVEAAR
NT seq 6033 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacgacgcatttcgtccgcgcggcgctggccgcgttcctgggcctggcctcg
gccggggcagcgcaggccctgtccgtctccagcttttcgccgcagggcgaggtcgcccgc
gtgcggcaggtggtggtgaaattcgatgccgctgccgtgaatttcggcgatccgaaggcc
cccgcgccgttctccgtggattgcggcggcgacgcgtccaggggcacgggccgctggacc
ggagagcgcgagtgggtgtacgacttcgcggcggacctgccgcccggcacgcgctgcacg
gccacggcccggtccggtttcaagtccgccagcggttcagccctgtcgggcacggtgcgc
taccagttcaataccggcggcccgttcgtgcagagcgtgcgccccggcacctaccagccc
atagacgaggagcagttcttcctgctgcagctgagcggcccggccaccctggagagcgtg
aaggccaacgtctggtgcgtggccgaggacgtgggcgagcgcatcccggtgcgcctcatc
gaaggcaccgaacgcgccgcgctgctgacttcgctgggcctggagagcgcggccaagcag
gcgcccctgcgctatgcgtcgctggcctgcaaccgccggctcacttcgggctccaaggtg
cagctggtgtacggccagggcgtggccacccccagcggggtgcccaacaccgtggagcgc
cgctacggctataccgtgcgcgaacccttcagcgccgagttcggctgcgagcgcgagaac
gcgcaggcggcctgcctgccgatccggccgatgcgcctgtcgttcaatgcgcccgtgccg
cgcaagctcgccgaggcgatccggctgaagtccgacaaggagaccctcaagccgcggctg
gacggcgagggcgacggcgacacggtggtcaacagcgtgcagttcatgccgcctttcgcg
ccgcagaccgccatgcgactggagctgcccaaggatttcaaggacgcttcgggccggccg
ctgcgcaatgcggacagctttccgctggccctgtccacgggccccatgccgccgctggcc
aagttcgcggcctcgccgttcggcgtggtcgagcgcttcgcggaaggcgacaagggcccg
gcgctgctgcccgtcaccctgcgcaatgtcgaggcggacctgcgtgtgcagggcctggcg
gccggagccgcccctggcgcctccgcacccgcggctgcgccggcgcccgcgggcaaggtg
agcaccttccagcccaccgccgatgcagacatcatcgcgtggtaccgccgggtgcgccgg
tacgacgactacctggtgacgcgcagggaggccagccgggacgtgcgtggcccgctgccc
caggtgctgcaggacgagggcaaggacacggtgcagtcgcgcatggtgtcgctgctcggc
gggcagccccgcgccagggtgctggacctgccgcgcccggcgtccggcgatccccgcccg
ttcgaggtggtcggcattccgctgccgccgggcttccacgtggtggagatcgcctcgccg
atgctgggccgctcgctgctggacgagcgccacggcgcggggcgcacgatgtacgtgcgc
acctccgccctcgtgaccaacctgggcgtgcacttcaagctggggcgcgagaacgccgcc
gcctgggtcaccacgctcgacaagggacaggtggtgccgggcgcggtggtgcgcgtgtcg
ggctgcgacggccgcgaactggccaccgcgaccaccgatgcccagggcatcgcgcgcttc
gagggcctgtcgccccagccgccctcgtgcccgggccgcgacggcctggagggcatgaat
gcctacttcgtgagcgcccgtgcccagggcgccgacggcgtgcaggacatggccttcacc
tggagcgactggcagcgcggcatcgagccgtggcgcttcaacgtgcccacgagcagccag
cccgagccggaccagatcgcgcacaccatcttcgaccgcactctgctgcgcgcgggcgag
acggtgtcgatgaagcacatcctgcgcacgcagaaccgccagggcttcggcctgcccgat
gcccagccgcacacgctggccatcacccacgtgggcagcggccagcaattcacccagccg
ctgcagtggcgtcgcacgcccacggggggcttgagcgcggagagcaccttcgcgctgccg
cccgctgccaagctgggcgtgtacagcgtcgaactgcgcggagacgacgacagccgtggc
cgcagcttcacctccggcgagttccgcgtggaggaattccgcctgcccgtgctggaaggc
cgcatcgcgccggccgacaagaagccgctggtgcggccccgttcggtgccgacggatgtg
caggtcaactacgtctccggtggcggcgcggccaacctgcccgtgcgcgtgtctgccctg
gtgcgcggcaagccgctgcagtttcccgatttcgacgccttcagtttcgagccgccgcgc
cgcaagggcgcgcagccccagggcggaaacagcggcgatgacgaagagcccgcctctgcc
gacgacgcgcgcgtgatcgccgacaagctggccgtgacgctcgaccgcaatggcgcgggc
aaggtggcgatcgacaacattcccaattcccgccgcgcgcaggacctggtgctcgaagcc
acgtattccgatcccaacggcgaggtgcagaccctgcgcagcacgcagacggtctggccg
gccgccgtggtggccggcatcaagaccgagggctgggtgtccgctgcgcagaagatccgc
ttccaggccctggcgctcggcctggacggcaaggtgcaggagggcgtgcccatgcaggtg
caggccgtggcccgtatcaccaccacgagccgcaagcgcatggtggggggcttctacagc
tacgacaacaagaccgagaccaaggacctgggaacggtctgcaccggcaagagcgacagc
cgcgggctggtgctgtgcgaggccaagctcgacgaggccggcgaagtcgaactggtggcc
accgcgcgcgacaaggacggcaaccagtccgaagcggccgcatcggtctgggtgacgcgg
cagggcgagctgtggttcggtggtgaagaccacgaccgcatcgacctgctgccagaaaag
aagagctatcagcccggggaaaccgcacggctgcaggtgcgcatgccgttccgccaggcc
acggccctggtgagcgtggagcgcgagggcatcatcgacatgcacgtggtgcagctcaat
ggccaggacccgacggtgcagctcaagatcgaggaaggctgggggccgaacgtctacgtg
agcgtgctggcgctgcgcgggcggctgcgcgaggtgccgtggtacagcttcttcacctgg
ggcttcaaggcgccgcgcgagtggtggacggccttctggtacgagggcaaggaatacgtc
gcgcccaccgccatggtggacctctccaagcccgcctaccggctgggcctggccgagatc
aaggtgggcgccaaagcgcaccgcatcgaggtgaaggtgacggccgacaaggagagctac
ccggtgcgcggcaaggcgcaggtcaccatcgccgccacgctacccgacggcaagcctgcg
gcgaatgccgaggtggccgtggccgccgtggaccaggccctgctggagctgatgcccaac
accagctggaacctgctggacgccatgctgcagcggcgcgcctggggcgtggaaacctcc
accgcccagatggagatcatcggccggcgccactacggcaagaaggccgtgccggcgggc
ggcggcggcggacgcgcgcagacgcgcgagctgctcgacaccctgctgctctggcagccc
gcggtgcgcctggatgcgaacggccgcgcgcaggtcacggtgccgctgaacgatgccctc
accaccttcaagatcgtcgcggtggcggatgcgggcacgggccagttcggcaccggctcc
accagcatccgggccacgcaggacctgcagatcatcagcggcctgccgccgctggtgcgc
gaggacgaccagttccgcgcccagttcacgctgcgcaacacgaccaaggcggccatgaag
gtcgaggtcgccccgcgcgccacgctgctcgcgctggacaagcagacggtggacatcccg
gccggcgaatcccgcgaagtggcctggaacgtgaccgcgcccgcgcaactcgcccgcacg
cgggccgaggcgatcctctgggagatcgaagcgcgcgacaccacgcccggcgccgcagga
gcgcgcgatgcgctcaaggccacgcagcggctcgtgccggccgtgccgctgacggtgcag
caggccaccctcgtgcaggtggacggcagtttcggcatcgacgtgaagccgcccgccgac
gccatccccggccgcggagggctgaagatgtcggtacagcccaagctcgccgaaggcctg
ccgggcgtgcgcgactggttcgccaactacccgttcctctgcctggagcagaagaccagc
aaggccgtgggcctgcgcgacggcaagatgtggcagaccgtggtggggcaactgcccacc
tacctggacggcgacgggctcgccagctacttcccgccgcaggcgggcagcggtaaccgc
ggcagcgacacgctcactgcctacctgctcgcggccacgcacgaggcctcgtccatcgat
cctgccttcgcactctcgccggaggtgcgcgcgccgatggagcgcggcctgatcgctttc
gtggagggccgcatccagcgcgacttctggagcccgcgcaaggacctggacatgcgcaag
ctcgcagcgatcgaggcgctgtcgcgctacggcaaggccacgggccgcatgctctcgtcc
atcaccgtggcgcccaaccagtggcccacgcacagcgtgatcgactggctgaacatactg
cggcgcgtgaccgacgcaccccagcgcgagcagcgcatggcggaggccacccagatcctc
aagtcccgcctgtcctaccagggcaccaagctgatcttcagctccgagcaggacgactac
tggtggtggctcatgcagaacggtgacgtgaatacggcgcggctcatgctggccgtgatg
gacgatccggcctggaaggacgacatggggcgcctggccaacggcttcatcgcgcggcag
cagggcggtgcctggcacaccaccacggccaacctctggggcggcctggcgctggagaaa
ttcagcgcgaagttcgaggccacgccggtcaccggattcacccgcgccgcgatgggcggc
aacaccgccagcgtggactggagcaaggtgggccgcgtgtccaccgccgatgccacgggc
gccgtgcaccagaccacgtggttcggtgcccccgcgtcgcccggcaacctgaccaacaac
ggcatgttcctgccgtggagcgcctcgggcggcaaggagacgcttaacgtgacccagcaa
ggcaccggcaagccctggctcacgctgcagtcggtggccgcggtccagctcaaggagccg
ttctccgccggctacaccgtcaagaagaccatcacgccggtggagcaggcggtggcgggg
cggtacacccgcggtgacgtgctgcgaatcaaactcgaggtcacctccaccgccgacatg
acctgggtggtgctcaccgacccggtacccggcggcgccaccatcctgggcaacggcctg
gggcgcgactccgagatcgcgacgcagggcgaaaagcgtggcagcggcggcagcggcggc
agcggctggctggcctacgaggagcgcagcttcgaggcctggcgcggctattacgagtac
gtgtccaaggggtcgctcacggccgaatacaccgtgcgcctgaacaacgtcggcgagttc
gccctcccgccgacgcgggtggaggcgatgtatgcgcccgagatgttcggagaaacgccg
aacccccgcatgaaggtggaagccgcgcgctga

DBGET integrated database retrieval system