KEGG   Acidovorax avenae: Acav_3211Help
Entry
Acav_3211         CDS       T01445                                 

Definition
(GenBank) Uncharacterized conserved protein UCP028704, OpgC
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpgC_C DUF1624 MrpF_PhaF
Motif
Other DBs
NCBI-ProteinID: ADX47113
UniProt: F0Q8B5
Position
3658386..3659567
Genome map
AA seq 393 aa AA seqDB search
MPETSTSRRWEIDAVRGLMLVLMTVTHLPTRLTMPLGQPFGFVSAAEGFVLLSAYMAGMV
YGRTAARRGIPSMRQAFLRRATKIYACQAATLLFLFTVITFIGIRVDEPAIKGLITFYLA
KPIEALVGGLLLVYEPPLLDILPIYVLFMLASPWVMSVGLRRGWAPVLAVSTALWFLAQF
GLSKWFYDAINTVISNPIPFHETGTFSMWGWQFLWVLGLWMGASRNDPEAPPFVFPRWAT
GAAAAIAVVGFCWRHAIGQVPFGDGLPEWNLVFDKWQLGPLRVLNLFALLVLAIRFGPPL
AARMPRPRWLETLGAASLPVFCAHLVVVLLAISLMGARYDRPWWQDIALLAVCFAALHAV
ARVSLWWDKGPDEDAPGAPRKLLRLRRPLPPAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaacctccacttcccgccgctgggagatcgatgccgtccggggactcatgctg
gtcctcatgacggtcacccatctgcccacgcggctcacgatgccgctcggccagcccttc
ggcttcgtctcggcggccgaggggttcgtgctgctgtccgcctacatggcgggcatggtg
tacggccgcaccgccgcccgccgcggcatcccgtccatgcggcaggccttcctgcgccgg
gccaccaagatctacgcctgccaggccgccaccctgctcttcctcttcaccgtgatcacc
ttcatcggcatccgggtggacgagccggccatcaagggcctgatcaccttctacctggca
aagccgatcgaggcgctcgtgggcgggctgctgctcgtgtacgagcccccgctgctcgac
atcctgcccatctacgtcctcttcatgctcgcaagcccctgggtgatgtcggtcgggctg
cggcgcggctgggcgccggtgctggccgtgagcaccgcgctgtggttcctggcgcagttc
gggctctcgaagtggttctacgacgccatcaataccgtcatcagcaatcccatacccttc
cacgagacgggcaccttctcgatgtggggctggcagttcctctgggtgctgggcctgtgg
atgggcgcgtcgcgcaacgatcccgaagcaccacccttcgtcttcccgcgctgggcgaca
ggggcggcggccgccatcgcggtagtgggtttctgctggcgccacgcgatcggccaggtc
cccttcggcgacggcctgcccgagtggaacctggtgttcgacaaatggcagctggggccg
ttgcgggtgctgaacctgttcgcgctgctcgtgctggcgatccggttcgggccgcccctg
gcggcgcgcatgccgcggccgcgctggctggaaaccctgggcgccgcctccctgccggtg
ttctgcgcccacctcgtggtggtgctgctcgccatcagcctgatgggggcacgctacgac
cggccgtggtggcaggacatcgccctgctggccgtctgcttcgcggccctgcacgccgtg
gcgcgggtcagcctgtggtgggacaaggggccggacgaagatgcgccgggcgccccgcgc
aaactgctgcgcctgcggcggcccctgcccccggcgctgtag

DBGET integrated database retrieval system