KEGG   Acidovorax avenae: Acav_3213Help
Entry
Acav_3213         CDS       T01445                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08224  MFS transporter, YNFM family, putative membrane transport protein
Organism
aaa  Acidovorax avenae
Brite
Transporters [BR:aaa02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Acriflavin-sensitivity (YnfM) family [TC:2.A.1.36]
    Acav_3213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ADX47115
UniProt: F0Q8B7
Position
complement(3660556..3661866)
Genome map
AA seq 436 aa AA seqDB search
MVSYPAFPASSSGSPDAAATPPSPSTPQGSATYADWVRRGTPEYRRAGLAMFLLGLASFS
LIYSVQPLLPAFASGFGVSPAESSLALSLTTGWLAFAIVLAGAFSQALGRRGLMCASMAL
AALLQIGAALAPTWHGLLVARALEGLVLGGVPAVAMAWLAEEIEPAALARTMGLYVGGTA
FGGMVGRVGMGLVTEFTSWRLALGGLGLLCLAAAAGFLRLLPPSRRFVRRPGINAQFHLR
AWAGHLRNPGLLRIYAIGFLLTSVFVTVFNYATFRVSGAPYHLGQTQASLIFLAFGFGIV
SSSVAGALADRFGRHRLLAAGFALMLAGVGLTLFAPLAAVVAGIALVTTGFFIGHAVASG
SVGPQAGEAKGHAASLYLLFYYLGSSVTGSAGGWFWQHGGWPAVAGLTGGIALAGLVAAA
ALGRAARVQPAAWAQG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggtctcttaccccgcctttcccgcttcgtcctccggcagcccggacgccgccgccact
cccccgtccccctctaccccgcaaggcagcgccacctatgccgactgggtgcggcgcggc
accccggagtaccgccgcgccggcctggcgatgttcctgctgggcctggccagcttttcg
ctgatctattcggtgcagcccctgctgcctgcgttcgcgtcgggtttcggcgtcagcccg
gcggagagctcgctcgcgctgtcgctcaccacgggctggctggccttcgccatcgtgctg
gccggcgctttctcgcaggccctcggccgccgcggcttgatgtgtgcttccatggcgctc
gcggcgctgctgcagatcggagcggccctcgcgcccacgtggcacggcctgctcgtggcc
cgggcgctggaagggctggtgctgggcggcgtgcccgccgtggccatggcgtggctggcc
gaggagatcgagcccgctgcccttgcgcgcaccatgggcctctatgtgggcggcacggcc
ttcggcggcatggtgggccgcgtggggatggggctggtcaccgagttcacctcgtggcgc
ctggcgctgggcgggctcggcctgctgtgccttgccgccgcggcaggcttcctgcggctg
cttccgccatcgcgccgcttcgtgcgccggcccggcatcaacgcgcagttccatctgcgc
gcatgggccgggcacctgcgcaatccggggctgctgcgcatctatgccatcggcttcctg
ctaaccagcgtcttcgtcacggtgttcaactacgccaccttccgggtgtcgggtgcgccc
tatcacctgggccagacgcaggccagcctgatcttcctggccttcggtttcggcatcgtg
tcctcgtcggtcgcaggcgccctggccgatcgtttcggccggcaccggctgctggccgcc
gggttcgcgctcatgctcgcgggcgttggcctgacgctgttcgcgccgctggctgcggtc
gtggccggcatcgcgctggtcaccaccggctttttcatcggccatgccgtggcgagcggt
tccgtggggccgcaggccggcgaggccaagggccatgcggcgtcgctctatctgctcttc
tattacctcggctccagcgtcacagggtctgcgggcggctggttctggcagcacggcgga
tggccggccgtggcgggcctgaccggcggcatcgcgctggccggcctggtggctgcggcg
gccctgggaagggcagcccgggtacagccagcggcatgggcccaaggatga

DBGET integrated database retrieval system