KEGG   Acidovorax avenae: Acav_3230Help
Entry
Acav_3230         CDS       T01445                                 

Definition
(GenBank) D-amino-acid dehydrogenase
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
aaa  Acidovorax avenae
Pathway
aaa00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Acav_3230
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     Acav_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox Pyr_redox_2 FAD_binding_2 HI0933_like FAD_oxidored UDPG_MGDP_dh_N ApbA FAD_binding_3 Thi4 XdhC_C AlaDh_PNT_C TrkA_N 3HCDH_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADX47132
UniProt: F0Q8D4
Position
3677579..3678847
Genome map
AA seq 422 aa AA seqDB search
MHACVMGAGIVGLATAYALERQGWQVTVIDQGPVGGGASGGNGAQLSYSYVQPLADASVW
GQLPKLLFSPDSPLKLRPQWSMRQWRWGAAFLAACNDATSRRTTGTLLELAARSRQAFEL
MREREGLDCDFSRTGKLVVYRSREALAGGERQMALQRAWGCEQESVSAARCVELEPALAH
DADHIAGAIHTPSECAADCQKVCDGLHTLLAARGVRFLLGSQVAGFTRGADGAVTTVHVR
SGASGAETPVAADQFVLALGSASASWAARLGIHVPVYPLKGYSITVDAPETAGWAPRVNV
TDAARKVVFARLGNRLRVAGMAELVGDDRSIPADRIERLRATVAAVLGHDPDTGAGLHPW
TGMRPATPTGLPVVGRRPGGPRNLWLHTGHGALGFTLSFGTAEQLAHAMAGERQAAQAAR
TA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcatgtgtgatgggtgccggcatcgtggggctggccacggcctatgcgctggag
cggcaggggtggcaggtgacggtgatcgaccagggcccggtgggtggcggtgccagcggc
ggcaacggcgcgcagctgagctacagctatgtgcagccgctggcggacgcctcggtatgg
gggcaattgcccaaactgctcttctcgccggactccccgctcaagctgcggccgcagtgg
agcatgcgccagtggcgctggggcgcggcgttcctcgcggcctgcaacgacgcgacgtcc
cgccgcaccaccggcacgctgctggagctggctgcgcgcagccggcaggccttcgagctc
atgcgcgagcgcgaggggctggattgcgatttcagccgcacgggcaagctcgtcgtgtac
cggtcgcgcgaggcactggccggcggtgaacggcagatggcgctgcagcgcgcgtggggc
tgcgagcaggagtcggtgtccgctgcccgctgcgtggagctggaacccgccctggcccac
gacgcggaccacatcgccggcgccatccacacgcccagcgaatgcgccgccgactgccag
aaagtctgcgacggcctgcacacgctgctcgccgcgcgcggcgtgcgcttcctgctgggc
tctcaggtggcgggattcacgcgcggcgcggacggcgcggtcaccacagtgcatgtgcgc
tccggcgcatcgggcgcggaaaccccggtggccgcggaccagttcgtgctggccctgggc
agcgcgagcgcgtcctgggcggcccgcctgggcatccacgtgcccgtctatccgctcaag
ggctacagcattacggtggacgcgcccgagaccgcgggatgggcaccccgggtgaacgtg
accgatgcggcccgcaaggtggtgttcgcgcggctgggcaaccgcctgcgcgtagccggc
atggcggaactcgtgggcgacgaccggagcattcccgcggaccgcatcgagcgcctgcgc
gccaccgtggccgcggtgctgggccacgaccccgacacgggcgccggcctgcacccctgg
accggcatgcgccccgccacccccaccggcctgcccgtcgtgggccgcaggccgggtggt
ccgcgcaacctgtggctgcacaccgggcatggggcgctgggcttcaccctgtccttcggc
acggcggagcagctcgcacacgccatggcaggcgaacgccaggccgcacaggccgcgcga
accgcctga

DBGET integrated database retrieval system