KEGG   Acidovorax avenae: Acav_3231Help
Entry
Acav_3231         CDS       T01445                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_Tnp_ISL3 P22_Cro YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: ADX47133
UniProt: F0Q8D5
Position
complement(3678853..3679794)
Genome map
AA seq 313 aa AA seqDB search
MRLRHIEVFNAVMLTGSVSAAARLINVTQPAVSRILSHAELQLGFALFHRHKGRLVPTRE
AQTLFPHIERLFTQLDEVQRLAGSLRGRQREGELHILSVLALSHEVMPRALRAFHALHPG
VQVTIESLHSPQIVSALVLQEADVGFVFSALSHPSLEQETLAEGSMVCIAPRGLLDAALV
ARGSVHLADLAGVPVVRLGLNDPLGTMVNHACREAEVGLASAITVQTYHAALALAHHGLG
VALVDACTAASADPARVNVLELLPRIAVPVKALRMPHRPASLLAEAMVRCMRDAAVETLQ
GGAGGLPAPAPGA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcgccatatcgaagtcttcaacgccgtcatgctcacgggcagcgtgagcgcc
gccgcgcgcctcatcaacgtcacgcagccggcggtgagccgcatcctctcccatgcagag
ttgcagctgggcttcgcgctgtttcaccgccacaaggggcggctggttcccacgcgggag
gcacagacgcttttcccgcacatcgagcgcctgttcacgcagctcgacgaagtgcagcgc
ctggcgggcagcctgcgggggcggcagcgcgagggcgagttgcacatcctcagcgtgctg
gcgctgagccacgaggtgatgccgcgggccctgcgcgccttccatgccctgcatcccggc
gtgcaggtgacgatcgaatccctgcattcgccgcagatcgtctccgctctggtgctgcag
gaggccgacgtgggcttcgtgttctcggcgctgtcgcatccctcgctggagcaggagacc
ctggccgagggcagcatggtgtgcatcgcgccgcgcggcctgctcgatgcggcgctcgtg
gcgcggggctcggtgcatctggcggatctggccggcgtgccggtggtgcggctggggctg
aacgatccgctgggcaccatggtgaaccacgcgtgcagggaggcggaagtggggctcgct
tccgccatcacggtgcagacctaccatgccgccctggcgctcgcgcaccatgggctgggg
gtggcactggtggacgcctgcaccgccgcgtccgcagacccggcgcgggtgaatgtgctg
gagctgttgccgcgcatcgccgtgccggtcaaggcgctgcgcatgccccatcgcccggcg
tccctgctggccgaggccatggtgcgctgcatgcgggatgccgccgtcgaaacgctgcag
ggcggcgcgggagggctgccggccccggcgcccggcgcctga

DBGET integrated database retrieval system