KEGG   Acidovorax avenae: Acav_3233Help
Entry
Acav_3233         CDS       T01445                                 

Definition
(GenBank) hypothetical protein
Organism
aaa  Acidovorax avenae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADX47135
UniProt: F0Q8D7
Position
3680813..3681508
Genome map
AA seq 231 aa AA seqDB search
MMATERRHRSPFRTGTLFFLAFSLAIACGEAPAKPKVSSKPRAAAKARKATKPRAPAPAA
ASQGDPLSSRVGVVDANTPGAVRLALASDTMAVPSAGLHYLSLAPAAKAPECCVRPQAAV
PPRDVAILRFDGDNSQLAAEHTAQFTQAPGEPFMGLALLGKATVTRASDQRLFLQWPDRK
VSVRVDHCVSGEAMHVRVADSAGPGQWQPAAYYYLPLAVPAPPDCPVDEAP
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatggccaccgaacgacgacaccgatcccccttccgtaccggcacactcttcttcctg
gctttttccctggcgatcgcctgcggcgaggcgcccgcgaagcccaaggtctccagcaag
ccgcgggctgccgccaaggcccgcaaagccaccaagccccgcgccccggcgcctgcagcg
gcctcgcagggcgatcccctgtcctcgcgcgtcggcgtggtggacgccaacactcccggc
gccgtgcggctcgcgctggcatcggacaccatggcggtgccttccgcaggcctgcactat
ctgtccctggcacccgccgcgaaagcgcccgaatgctgcgtccggccgcaggccgccgtg
ccgccccgggatgtcgccatcctgcgcttcgacggcgacaattcgcaactggcggccgaa
cacacggcccagttcacgcaggcgccgggcgaacccttcatggggctggcgctgctgggc
aaggccacggtcacccgggcttccgaccagcggctgttcctgcaatggccggaccgcaag
gtgtcggtgcgcgtggaccactgtgtttccggggaggccatgcatgtgcgcgtggccgac
agcgcgggccccggccaatggcagcctgcggcctactattacctgccgctcgcggtgccg
gccccgccggactgcccggtggacgaggcgccctga

DBGET integrated database retrieval system